Details of Protein
General Information of Protein (ID: PRT00412) | |||||
---|---|---|---|---|---|
Name | Histone H3 (SIN2) | ||||
Synonyms |
Click to Show/Hide Synonyms of This Protein
YBR010W; YNL031C; YBR0201; N2749; HHT1; HHT2; SIN2
|
||||
Gene Name | HHT1 | Gene ID | |||
UniProt ID | |||||
Family | Histone (HST) | ||||
Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein | |||||
Sequence |
MARTKQTARKSTGGKAPRKQLASKAARKSAPSTGGVKKPHRYKPGTVALREIRRFQKSTE
LLIRKLPFQRLVREIAQDFKTDLRFQSSAIGALQESVEAYLVSLFEDTNLAAIHAKRVTI QKKDIKLARRLRGERS |
||||
Structure | |||||
Function | Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling. Component of the UAF (upstream activation factor) complex which interacts with the upstream element of the RNA polymerase I promoter and forms a stable preinitiation complex. Together with SPT15/TBP, UAF seems to stimulate basal transcription to a fully activated level. | ||||
Regulatory Network | |||||
Full List of Metabolite(s) Regulating This Protein | ||||||
---|---|---|---|---|---|---|
Homogeneous non-metal compounds | ||||||
Nitrogen | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
Detailed Information |
Metabo Info
![]() |
|||||
Regulating Pair |
Experim Info
![]() |
[1] | ||||
Introduced Variation | Nitrogen limitation (1.50 hours) | |||||
Induced Change | HHT1 MORE protein expression levels: increase | |||||
Summary | Introduced Variation
![]() ![]() ![]() |
|||||
Disease Status | Healthy individual | |||||
Details | It is reported that nitrogen limitation causes the increase of HHT1 MORE protein expression compared with control group. | |||||
References | |||||
---|---|---|---|---|---|
1 | Proteome analysis of yeast response to various nutrient limitations. Mol Syst Biol. 2006;2:2006.0026. |
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.