Details of Protein

General Information of Protein (ID: PRT00412)
Name Histone H3 (SIN2)
Synonyms   Click to Show/Hide Synonyms of This Protein
YBR010W; YNL031C; YBR0201; N2749; HHT1; HHT2; SIN2
Gene Name HHT1 Gene ID
852295
UniProt ID
P61830
Family Histone (HST)
  Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein
Sequence
MARTKQTARKSTGGKAPRKQLASKAARKSAPSTGGVKKPHRYKPGTVALREIRRFQKSTE
LLIRKLPFQRLVREIAQDFKTDLRFQSSAIGALQESVEAYLVSLFEDTNLAAIHAKRVTI
QKKDIKLARRLRGERS
Structure
1ID3 ; 1M1D ; 1PEG ; 1PU9 ; 1PUA ; 1QSN ; 2CNX ; 2H2G ; 2IDC ; 2JMJ ; 2RNW ; 2RNX ; 2RSN ; 3MP1 ; 3MP6 ; 3Q33 ; 4JJN ; 4KUD ; 4PSX ; 5D7E ; 5IOK ; 5ZBA ; 5ZBB ; 6GEJ ; 6GEN ; 6J2P ; 6KMJ
Function Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling. Component of the UAF (upstream activation factor) complex which interacts with the upstream element of the RNA polymerase I promoter and forms a stable preinitiation complex. Together with SPT15/TBP, UAF seems to stimulate basal transcription to a fully activated level.
Regulatory Network
Full List of Metabolite(s) Regulating This Protein
      Homogeneous non-metal compounds
            Nitrogen Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Nitrogen limitation (1.50 hours)
                      Induced Change HHT1 MORE protein expression levels: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that nitrogen limitation causes the increase of HHT1 MORE protein expression compared with control group.
References
1 Proteome analysis of yeast response to various nutrient limitations. Mol Syst Biol. 2006;2:2006.0026.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.