Details of Protein

General Information of Protein (ID: PRT00411)
Name Histone H2B 1-C/E/F/G/I (H2BC4)
Synonyms   Click to Show/Hide Synonyms of This Protein
Histone H2B.1 A; Histone H2B.a; H2B/a; Histone H2B.g; H2B/g; Histone H2B.h; H2B/h; Histone H2B.k; H2B/k; Histone H2B.l; H2B/l; H2BC4; H2BC6; H2BC7; H2BC8; H2BC10; H2BFL; HIST1H2BC; H2BFH; HIST1H2BE; H2BFG; HIST1H2BF; H2BFA; HIST1H2BG; H2BFK; HIST1H2BI
Gene Name H2BC4 Gene ID
3017
UniProt ID
P62807
Family Histone (HST)
  Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein
Sequence
MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM
GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT
KYTSSK
Structure
5GT0 ; 5KGF ; 6ACO ; 6C0W ; 6FML ; 6R0C ; 6RNY ; 6SE0 ; 6SE6 ; 6SEE ; 6SEF ; 6SEG ; 6UPK ; 6UPL ; 6X59 ; 6X5A ; 6XJD ; 7A08 ; 7JO9 ; 7JOA
Function Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.; Has broad antibacterial activity. May contribute to the formation of the functional antimicrobial barrier of the colonic epithelium, and to the bactericidal activity of amniotic fluid.
Regulatory Network
Full List of Metabolite(s) Regulating This Protein
      Organic acids and derivatives
            Arginine Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Arginine decrease (48 hours)
                      Induced Change H2BC4 MORE protein abundance levels: increase (FC = 3.7)
                      Summary Introduced Variation         Induced Change 
                      Disease Status Colon cancer [ICD-11: 2B90]
                      Details It is reported that arginine decrease causes the increase of H2BC4 MORE protein abundance compared with control group.
            Glutamine Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [2]
                      Introduced Variation Glutamine absence (16 hours)
                      Induced Change H2BC4 MORE protein abundance levels: increase (FC = 2.04)
                      Summary Introduced Variation         Induced Change 
                      Disease Status Hepatocellular carcinoma [ICD-11: 2C12]
                      Details It is reported that glutamine absence causes the increase of H2BC4 MORE protein abundance compared with control group.
References
1 Arginine deficiency in preconfluent intestinal Caco-2 cells modulates expression of proteins involved in proliferation, apoptosis, and heat shock response. Proteomics. 2007 Feb;7(4):565-577.
2 Quantitative proteomics analysis reveals glutamine deprivation activates fatty acid -oxidation pathway in HepG2 cells. Amino Acids. 2016 May;48(5):1297-307.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.