Details of Protein

General Information of Protein (ID: PRT00407)
Name Histone H2A type 1 (H2AC11)
Synonyms   Click to Show/Hide Synonyms of This Protein
H2A.1; Histone H2A/ptl; H2AC11; H2AC13; H2AC15; H2AC16; H2AC17; H2AFP; HIST1H2AG; H2AFC; HIST1H2AI; H2AFD; HIST1H2AK; H2AFI; HIST1H2AL; H2AFN; HIST1H2AM
Gene Name H2AC11 Gene ID
8329
UniProt ID
P0C0S8
Family Histone (HST)
  Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein
Sequence
MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLT
AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKK
TESHHKAKGK
Structure
4QYL ; 5KGF ; 6R0C ; 6RNY ; 6X59 ; 6X5A ; 6XJD ; 7JO9 ; 7JOA
Function Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.
Regulatory Network
Full List of Metabolite(s) Regulating This Protein
      Organic acids and derivatives
            Glutamine Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Glutamine absence (16 hours)
                      Induced Change H2AC11 MORE protein abundance levels: increase (FC = 1.87)
                      Summary Introduced Variation         Induced Change 
                      Disease Status Hepatocellular carcinoma [ICD-11: 2C12]
                      Details It is reported that glutamine absence causes the increase of H2AC11 MORE protein abundance compared with control group.
References
1 Quantitative proteomics analysis reveals glutamine deprivation activates fatty acid -oxidation pathway in HepG2 cells. Amino Acids. 2016 May;48(5):1297-307.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.