Details of Protein
| General Information of Protein (ID: PRT00404) | |||||
|---|---|---|---|---|---|
| Name | Interleukin-18 (IL18) | ||||
| Synonyms |
Click to Show/Hide Synonyms of This Protein
IL-18; Interferon gamma-inducing factor; IFN-gamma-inducing factor; Interleukin-1 gamma; IL-1 gamma; Il18; Igif
|
||||
| Gene Name | Il18 | Gene ID | |||
| UniProt ID | |||||
| Family | Interleukin (IL) | ||||
| Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein | |||||
| Sequence |
MAAMSEEGSCVNFKEMMFIDNTLYLIPEDNGDLESDHFGRLHCTTAVIRSINDQVLFVDK
RNPPVFEDMPDIDRTANESQTRLIIYMYKDSEVRGLAVTLSVKDGRMSTLSCKNKIISFE EMNPPENIDDIKSDLIFFQKRVPGHNKMEFESSLYEGHFLACQKEDDAFKLVLKRKDENG DKSVMFTLTNLHQS |
||||
| Function | A proinflammatory cytokine primarily involved in polarized T-helper 1 (Th1) cell and natural killer (NK) cell immune responses. Upon binding to IL18R1 and IL18RAP, forms a signaling ternary complex which activates NF-kappa-B, triggering synthesis of inflammatory mediators. Synergizes with IL12/interleukin-12 to induce IFNG synthesis from T-helper 1 (Th1) cells and natural killer (NK) cells. | ||||
| Regulatory Network | |||||
| Full List of Metabolite(s) Regulating This Protein | ||||||
|---|---|---|---|---|---|---|
| Organic acids and derivatives | ||||||
| Glutamine | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
| Detailed Information |
Metabo Info
click to show the details of this metabolite
|
|||||
| Regulating Pair |
Experim Info
click to show the details of experiment for validating this pair
|
[1] | ||||
| Introduced Variation | Glutamine addition (6 hours) | |||||
| Induced Change | IL18 protein expression levels: decrease | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Sepsis [ICD-11: 1G40] | |||||
| Details | It is reported that glutamine addition causes the decrease of IL18 protein expression compared with control group. | |||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.

