Details of Protein

General Information of Protein (ID: PRT00402)
Name Antioxidant protein 2 (PRDX6)
Synonyms   Click to Show/Hide Synonyms of This Protein
1-Cys peroxiredoxin; 1-Cys PRX; Acidic calcium-independent phospholipase A2; aiPLA2; Antioxidant protein 2; Glutathione-dependent peroxiredoxin; Lysophosphatidylcholine acyltransferase 5; LPC acyltransferase 5; LPCAT-5; Lyso-PC acyltransferase 5; Non-selenium glutathione peroxidase; NSGPx; Prdx6; Aop2; Ltw4; Prdx5
Gene Name Prdx6 Gene ID
11758
UniProt ID
O08709
Family Oxidoreductases (EC 1)
EC Number   EC: 1.11.1.27  (Click to Show/Hide the Complete EC Tree)
Oxidoreductase
Peroxidase
Peroxidase
EC: 1.11.1.27
  Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein
Sequence
MPGGLLLGDEAPNFEANTTIGRIRFHDFLGDSWGILFSHPRDFTPVCTTELGRAAKLAPE
FAKRNVKLIALSIDSVEDHLAWSKDINAYNGETPTEKLPFPIIDDKGRDLAILLGMLDPV
EKDDNNMPVTARVVFIFGPDKKLKLSILYPATTGRNFDEILRVVDSLQLTGTKPVATPVD
WKKGESVMVVPTLSEEEAKQCFPKGVFTKELPSGKKYLRYTPQP
Function Thiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides to water and alcohols, respectively. Can reduce H(2)O(2) and short chain organic, fatty acid, and phospholipid hydroperoxides. Has phospholipase activity. Can either reduce the oxidized sn-2 fatty acyl group of phospholipids (peroxidase activity) or hydrolyze the sn-2 ester bond of phospholipids (phospholipase activity). These activities are dependent on binding to phospholipids at acidic pH and to oxidized phospholipds at cytosolic pH. Plays a role in cell protection against oxidative stress by detoxifying peroxides and in phospholipid homeostasis. Exhibits acyl-CoA-dependent lysophospholipid acyltransferase which mediates the conversion of lysophosphatidylcholine (1-acyl-sn-glycero-3-phosphocholine or LPC) into phosphatidylcholine (1,2-diacyl-sn-glycero-3-phosphocholine or PC). Shows a clear preference for LPC as the lysophospholipid and for palmitoyl CoA as the fatty acyl substrate.
Regulatory Network
Full List of Metabolite(s) Regulating This Protein
      Organic acids and derivatives
            Methionine Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Methionine decrease (504 hours)
                      Induced Change PRDX6 protein expression levels: decrease (FC = 0.47)
                      Summary Introduced Variation         Induced Change 
                      Disease Status Fatty liver disease [ICD-11: DB92]
                      Details It is reported that methionine decrease causes the decrease of PRDX6 protein expression compared with control group.
References
1 Proteomic analysis of mice fed methionine and choline deficient diet reveals marker proteins associated with steatohepatitis. PLoS One. 2015 Apr 7;10(4):e0120577.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.