Details of Protein

General Information of Protein (ID: PRT00384)
Name Zinc finger protein 593 (ZNF593)
Synonyms   Click to Show/Hide Synonyms of This Protein
Zinc finger protein T86; Znf593; Zfp593
Gene Name Znf593 Gene ID
68040
UniProt ID
Q9DB42
Family Zinc finger protein (ZIN)
  Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein
Sequence
MGRSRRTGAHRAHSLARQMKAKKRRPDLDEIHRELRPQGLPRPKPEPDAEPDPDLPGGGL
HRCLACARYFIDSANLKTHFRSKDHKKRLKQLSVEPYSQEEAERAAGMGSYVQPQRLGVP
TEVSTDIPEMDTST
Function Negatively modulates the DNA binding activity of Oct-2 and therefore its transcriptional regulatory activity. Could act either by binding to DNA octamer or by interacting with Oct-2. May also be a modulator of other octamer-binding proteins.
Regulatory Network
Full List of Metabolite(s) Regulating This Protein
      Organic oxygen compounds
            Glucose Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Glucose (low concentration) addition (17.50 hours)
                      Induced Change ZNF593 protein abundance levels: increase (FC = 1.89)
                      Summary Introduced Variation         Induced Change 
                      Disease Status Cerebral stroke [ICD-11: 8B11]
                      Details It is reported that low glucose addition causes the increase of ZNF593 protein abundance compared with control group.
References
1 Quantitative Proteomics Reveals the Beneficial Effects of Low Glucose on Neuronal Cell Survival in an in vitro Ischemic Penumbral Model. Front Cell Neurosci. 2020 Sep 1;14:272.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.