Details of Protein

General Information of Protein (ID: PRT00378)
Name L-name-related protein 42 (LNR42)
Synonyms   Click to Show/Hide Synonyms of This Protein
Ribosome biogenesis protein NSA2 homolog; TGF-beta-inducible nuclear protein 1; Nsa2; Tinp1
Gene Name Nsa2 Gene ID
59050
UniProt ID
Q9CR47
Family Ribosomal protein (Ribo)
  Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein
Sequence
MPQNEYIELHRKRYGYRLDYHEKKRKKEGREAHERSKKAKKMIGLKAKLYHKQRHAEKIQ
MKKTIKMHEKRNTKQKDDEKTPQGAVPAYLLDREGQSRAKVLSNMIKQKRKEKAGKWEVP
LPKVRAQGETEVLKVIRTGKRKKKAWKRMVTKVCFVGDGFTRKPPKYERFIRPMGLRFKK
AHVTHPELKATFCLPILGVKKNPSSPLYTTLGVITKGTVIEVNVSELGLVTQGGKVIWGK
YAQVTNNPENDGCINAVLLV
Function Involved in the biogenesis of the 60S ribosomal subunit. May play a part in the quality control of pre-60S particles.
Regulatory Network
Full List of Metabolite(s) Regulating This Protein
      Organic oxygen compounds
            Glucose Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Glucose (low concentration) addition (17.50 hours)
                      Induced Change NSA2 protein abundance levels: decrease (FC = 2.23)
                      Summary Introduced Variation         Induced Change 
                      Disease Status Cerebral stroke [ICD-11: 8B11]
                      Details It is reported that low glucose addition causes the decrease of NSA2 protein abundance compared with control group.
References
1 Quantitative Proteomics Reveals the Beneficial Effects of Low Glucose on Neuronal Cell Survival in an in vitro Ischemic Penumbral Model. Front Cell Neurosci. 2020 Sep 1;14:272.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.