Details of Protein
| General Information of Protein (ID: PRT00360) | |||||
|---|---|---|---|---|---|
| Name | VHL binding protein 1 (VBP1) | ||||
| Synonyms |
Click to Show/Hide Synonyms of This Protein
Prefoldin subunit 3; HIBBJ46; von Hippel-Lindau-binding protein 1; VBP-1; VHL-binding protein 1; VBP1; PFDN3
|
||||
| Gene Name | VBP1 | Gene ID | |||
| UniProt ID | |||||
| Family | Prefoldin (Pref) | ||||
| Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein | |||||
| Sequence |
MAAVKDSCGKGEMATGNGRRLHLGIPEAVFVEDVDSFMKQPGNETADTVLKKLDEQYQKY
KFMELNLAQKKRRLKGQIPEIKQTLEILKYMQKKKESTNSMETRFLLADNLYCKASVPPT DKVCLWLGANVMLEYDIDEAQALLEKNLSTATKNLDSLEEDLDFLRDQFTTTEVNMARVY NWDVKRRNKDDSTKNKA |
||||
| Structure | |||||
| Function | Binds specifically to cytosolic chaperonin (c-CPN) and transfers target proteins to it. Binds to nascent polypeptide chain and promotes folding in an environment in which there are many competing pathways for nonnative proteins. | ||||
| Regulatory Network | |||||
| Full List of Metabolite(s) Regulating This Protein | ||||||
|---|---|---|---|---|---|---|
| Organic acids and derivatives | ||||||
| Methionine | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
| Detailed Information |
Metabo Info
 click to show the details of this metabolite
|
|||||
| Regulating Pair |
Experim Info
click to show the details of experiment for validating this pair
|
[1] | ||||
| Introduced Variation | Methionine decrease (120 hours) | |||||
| Induced Change | VBP1 protein expression levels: decrease | |||||
| Summary | Introduced Variation
Induced Change
|
|||||
| Disease Status | Stomach cancer [ICD-11: 2B72] | |||||
| Details | It is reported that methionine decrease causes the decrease of VBP1 protein expression compared with control group. | |||||
| References | |||||
|---|---|---|---|---|---|
| 1 | Applying proteomic methodologies to analyze the effect of methionine restriction on proliferation of human gastric cancer SGC7901 cells. Clin Chim Acta. 2007 Feb;377(1-2):206-12. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.