Details of Protein

General Information of Protein (ID: PRT00354)
Name Beta catenin interacting 1 (CTNNBIP1)
Synonyms   Click to Show/Hide Synonyms of This Protein
Inhibitor of beta-catenin and Tcf-4; CTNNBIP1; ICAT
Gene Name CTNNBIP1 Gene ID
56998
UniProt ID
Q9NSA3
Family Beta-catenin-interacting protein (BCIP)
  Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein
Sequence
MNREGAPGKSPEEMYIQQKVRVLLMLRKMGSNLTASEEEFLRTYAGVVNSQLSQLPPHSI
DQGAEDVVMAFSRSETEDRRQ
Structure
1LUJ ; 1M1E ; 1T08
Function Prevents the interaction between CTNNB1 and TCF family members, and acts as negative regulator of the Wnt signaling pathway.
Regulatory Network
Full List of Metabolite(s) Regulating This Protein
      Organic acids and derivatives
            Glutamine Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Glutamine addition (24 hours)
                      Induced Change CTNNBIP1 protein expression levels: decrease
                      Summary Introduced Variation         Induced Change 
                      Disease Status Colon cancer [ICD-11: 2B90]
                      Details It is reported that glutamine addition causes the decrease of CTNNBIP1 protein expression compared with control group.
References
1 Glutamine regulates the human epithelial intestinal HCT-8 cell proteome under apoptotic conditions. Mol Cell Proteomics. 2007 Oct;6(10):1671-9.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.