Details of Protein
General Information of Protein (ID: PRT00345) | |||||
---|---|---|---|---|---|
Name | CCG1-interacting factor B (ABHD14B) | ||||
Synonyms |
Click to Show/Hide Synonyms of This Protein
Alpha/beta hydrolase domain-containing protein 14B; Abhydrolase domain-containing protein 14B; CCG1-interacting factor B; Abhd14b; Cib
|
||||
Gene Name | Abhd14b | Gene ID | |||
UniProt ID | |||||
Family | Hydrolases (EC 3) | ||||
EC Number | EC: 3.-.-.- (Click to Show/Hide the Complete EC Tree) | ||||
Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein | |||||
Sequence |
MAGVDQHEGTIQVQGQNLFFRETRPGSGQPVRFSVLLLHGIRFSSETWQNLGTLQRLAEA
GYRAVAIDLPGLGRSKEAAAPAPIGEPAPGSFLAAVVDTLELGPPVVISPSLSGMYSLPF LVAPGSQLRGFVPVAPICTDKINAVDYASVKTPALIVYGDQDPMGSSSFQHLKQLPNHRV LVMEGAGHPCYLDKPDEWHKGLLDFLQGLA |
||||
Function | Has hydrolase activity towards p-nitrophenyl butyrate (in vitro). May activate transcription. | ||||
Regulatory Network | |||||
Full List of Metabolite(s) Regulating This Protein | ||||||
---|---|---|---|---|---|---|
Organic acids and derivatives | ||||||
Methionine | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
Detailed Information |
Metabo Info
![]() |
|||||
Regulating Pair |
Experim Info
![]() |
[1] | ||||
Introduced Variation | Methionine decrease (504 hours) | |||||
Induced Change | ABHD14B protein expression levels: increase (FC = 1.64) | |||||
Summary | Introduced Variation
![]() ![]() ![]() |
|||||
Disease Status | Fatty liver disease [ICD-11: DB92] | |||||
Details | It is reported that methionine decrease causes the increase of ABHD14B protein expression compared with control group. | |||||
References | |||||
---|---|---|---|---|---|
1 | Proteomic analysis of mice fed methionine and choline deficient diet reveals marker proteins associated with steatohepatitis. PLoS One. 2015 Apr 7;10(4):e0120577. |
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.