Details of Protein

General Information of Protein (ID: PRT00345)
Name CCG1-interacting factor B (ABHD14B)
Synonyms   Click to Show/Hide Synonyms of This Protein
Alpha/beta hydrolase domain-containing protein 14B; Abhydrolase domain-containing protein 14B; CCG1-interacting factor B; Abhd14b; Cib
Gene Name Abhd14b Gene ID
.
UniProt ID
Q8VCR7
Family Hydrolases (EC 3)
EC Number   EC: 3.-.-.-  (Click to Show/Hide the Complete EC Tree)
Hydrolases
.
.
EC: 3.-.-.-
  Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein
Sequence
MAGVDQHEGTIQVQGQNLFFRETRPGSGQPVRFSVLLLHGIRFSSETWQNLGTLQRLAEA
GYRAVAIDLPGLGRSKEAAAPAPIGEPAPGSFLAAVVDTLELGPPVVISPSLSGMYSLPF
LVAPGSQLRGFVPVAPICTDKINAVDYASVKTPALIVYGDQDPMGSSSFQHLKQLPNHRV
LVMEGAGHPCYLDKPDEWHKGLLDFLQGLA
Function Has hydrolase activity towards p-nitrophenyl butyrate (in vitro). May activate transcription.
Regulatory Network
Full List of Metabolite(s) Regulating This Protein
      Organic acids and derivatives
            Methionine Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Methionine decrease (504 hours)
                      Induced Change ABHD14B protein expression levels: increase (FC = 1.64)
                      Summary Introduced Variation         Induced Change 
                      Disease Status Fatty liver disease [ICD-11: DB92]
                      Details It is reported that methionine decrease causes the increase of ABHD14B protein expression compared with control group.
References
1 Proteomic analysis of mice fed methionine and choline deficient diet reveals marker proteins associated with steatohepatitis. PLoS One. 2015 Apr 7;10(4):e0120577.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.