Details of Protein
| General Information of Protein (ID: PRT00314) | |||||
|---|---|---|---|---|---|
| Name | Aldehyde dehydrogenase 9A1 (ALDH9A1) | ||||
| Synonyms |
Click to Show/Hide Synonyms of This Protein
TMABA-DH; TMABADH; 4-trimethylaminobutyraldehyde dehydrogenase; Aldh9a1
|
||||
| Gene Name | Aldh9a1 | Gene ID | |||
| UniProt ID | |||||
| Family | Oxidoreductases (EC 1) | ||||
| EC Number | EC: 1.2.1.47 (Click to Show/Hide the Complete EC Tree) | ||||
| Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein | |||||
| Sequence |
MSTGTFVVSQPLNYRGGARVEPVDASGTEKAFEPATGRVIATFACSGEKEVNLAVENAKA
AFKLWSKKSGLERCQVLLEAARIIKERKDEIATVETINNGKSIFEARLDVDTCWQCLEYY AGLAASMAGEHIQLPGGSFGYTRREPLGVCVGIGAWNYPFQIACWKSAPALACGNAMIFK PSPFTPVSALLLAEIYTKAGAPPGLFNVVQGGAATGQFLCHHREVAKISFTGSVPTGVKI MEMSAKGVKPITLELGGKSPLIIFSDCNMENAVKGALMANFLTQGQVCCNGTRVFVQKEI ADKFINEVVKQTQKIKLGDPLLEDTRMGPLINAPHLERVLGFVKLAKEQGATVLCGGEVY VPEDPKLKHGYYMTPCILTNCRDDMTCVKEEIFGPVMSILTFGTEAEVLERANDTTFGLA AGVFTRDIQRAHRVAAELQAGTCYINNYNVSPVELPFGGYKKSGFGRENGRVTIEYYSQL KTVCVEMGDVESAF |
||||
| Function | Converts gamma-trimethylaminobutyraldehyde into gamma-butyrobetaine with high efficiency (in vitro). Can catalyze the irreversible oxidation of a broad range of aldehydes to the corresponding acids in an NAD-dependent reaction, but with low efficiency. | ||||
| Regulatory Network | |||||
| Full List of Metabolite(s) Regulating This Protein | ||||||
|---|---|---|---|---|---|---|
| Organic acids and derivatives | ||||||
| Methionine | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
| Detailed Information |
Metabo Info
click to show the details of this metabolite
|
|||||
| Regulating Pair |
Experim Info
click to show the details of experiment for validating this pair
|
[1] | ||||
| Introduced Variation | Methionine addition (336 hours) | |||||
| Induced Change | ALDH9A1 protein expression levels: increase | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Hyperhomocysteinaemia [ICD-11: 3B61] | |||||
| Details | It is reported that methionine addition causes the increase of ALDH9A1 protein expression compared with control group. | |||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.

