Details of Protein
General Information of Protein (ID: PRT00306) | |||||
---|---|---|---|---|---|
Name | Heat shock protein 31 (HSP31) | ||||
Synonyms |
Click to Show/Hide Synonyms of This Protein
Glyoxalase 3 homolog 1; Glutathione-independent glyoxalase HSP31; YDR533C; D9719.36; HSP31
|
||||
Gene Name | HSP31 | Gene ID | |||
UniProt ID | |||||
Family | Lyases (EC 4) | ||||
EC Number | EC: 4.2.1.130 (Click to Show/Hide the Complete EC Tree) | ||||
Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein | |||||
Sequence |
MAPKKVLLALTSYNDVFYSDGAKTGVFVVEALHPFNTFRKEGFEVDFVSETGKFGWDEHS
LAKDFLNGQDETDFKNKDSDFNKTLAKIKTPKEVNADDYQIFFASAGHGTLFDYPKAKDL QDIASEIYANGGVVAAVCHGPAIFDGLTDKKTGRPLIEGKSITGFTDVGETILGVDSILK AKNLATVEDVAKKYGAKYLAPVGPWDDYSITDGRLVTGVNPASAHSTAVRSIDALKN |
||||
Structure | |||||
Function | Catalyzes the conversion of methylglyoxal (MG) to D-lactate in a single glutathione (GSH)-independent step. May play a role in detoxifying endogenously produced glyoxals. Involved in protection against reactive oxygen species (ROS). Important for viability in stationary phase. May negatively regulate TORC1 in response to nutrient limitation. | ||||
Regulatory Network | |||||
Full List of Metabolite(s) Regulating This Protein | ||||||
---|---|---|---|---|---|---|
Homogeneous non-metal compounds | ||||||
Nitrogen | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
Detailed Information |
Metabo Info
![]() |
|||||
Regulating Pair |
Experim Info
![]() |
[1] | ||||
Introduced Variation | Nitrogen limitation (1.50 hours) | |||||
Induced Change | HSP31 protein expression levels: increase | |||||
Summary | Introduced Variation
![]() ![]() ![]() |
|||||
Disease Status | Healthy individual | |||||
Details | It is reported that nitrogen limitation causes the increase of HSP31 protein expression compared with control group. | |||||
References | |||||
---|---|---|---|---|---|
1 | Proteome analysis of yeast response to various nutrient limitations. Mol Syst Biol. 2006;2:2006.0026. |
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.