Details of Protein
| General Information of Protein (ID: PRT00285) | |||||
|---|---|---|---|---|---|
| Name | Phosphoenolpyruvate carboxykinase 2 (PCK2) | ||||
| Synonyms |
Click to Show/Hide Synonyms of This Protein
PEPCK-M; PCK2; PEPCK2
|
||||
| Gene Name | PCK2 | Gene ID | |||
| UniProt ID | |||||
| Family | Lyases (EC 4) | ||||
| EC Number | EC: 4.1.1.32 (Click to Show/Hide the Complete EC Tree) | ||||
| Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein | |||||
| Sequence |
MAALYRPGLRLNWHGLSPLGWPSCRSIQTLRVLSGDLGQLPTGIRDFVEHSARLCQPEGI
HICDGTEAENTATLTLLEQQGLIRKLPKYNNCWLARTDPKDVARVESKTVIVTPSQRDTV PLPPGGARGQLGNWMSPADFQRAVDERFPGCMQGRTMYVLPFSMGPVGSPLSRIGVQLTD SAYVVASMRIMTRLGTPVLQALGDGDFVKCLHSVGQPLTGQGEPVSQWPCNPEKTLIGHV PDQREIISFGSGYGGNSLLGKKCFALRIASRLARDEGWLAEHMLILGITSPAGKKRYVAA AFPSACGKTNLAMMRPALPGWKVECVGDDIAWMRFDSEGRLRAINPENGFFGVAPGTSAT TNPNAMATIQSNTIFTNVAETSDGGVYWEGIDQPLPPGVTVTSWLGKPWKPGDKEPCAHP NSRFCAPARQCPIMDPAWEAPEGVPIDAIIFGGRRPKGVPLVYEAFNWRHGVFVGSAMRS ESTAAAEHKGKIIMHDPFAMRPFFGYNFGHYLEHWLSMEGRKGAQLPRIFHVNWFRRDEA GHFLWPGFGENARVLDWICRRLEGEDSARETPIGLVPKEGALDLSGLRAIDTTQLFSLPK DFWEQEVRDIRSYLTEQVNQDLPKEVLAELEALERRVHKM |
||||
| Function | Catalyzes the conversion of oxaloacetate (OAA) to phosphoenolpyruvate (PEP), the rate-limiting step in the metabolic pathway that produces glucose from lactate and other precursors derived from the citric acid cycle. | ||||
| Regulatory Network | |||||
| Full List of Metabolite(s) Regulating This Protein | ||||||
|---|---|---|---|---|---|---|
| Nucleosides, nucleotides, and analogues | ||||||
| AICAR | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
| Detailed Information |
Metabo Info
click to show the details of this metabolite
|
|||||
| Regulating Pair |
Experim Info
click to show the details of experiment for validating this pair
|
[1] | ||||
| Introduced Variation | AICAR addition (24 hours) | |||||
| Induced Change | PCK2 mRNA levels: decrease (FC = 0.19) | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Obesity [ICD-11: 5B81] | |||||
| Details | It is reported that AICAR addition causes the decrease of PCK2 mRNA levels compared with control group. | |||||
| Organic acids and derivatives | ||||||
| Arginine | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
| Detailed Information |
Metabo Info
click to show the details of this metabolite
|
|||||
| Regulating Pair |
Experim Info
click to show the details of experiment for validating this pair
|
[2] | ||||
| Introduced Variation | Arginine decrease (48 hours) | |||||
| Induced Change | PCK2 protein abundance levels: increase (FC = 1.6) | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Colon cancer [ICD-11: 2B90] | |||||
| Details | It is reported that arginine decrease causes the increase of PCK2 protein abundance compared with control group. | |||||
| Glutamine | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
| Detailed Information |
Metabo Info
click to show the details of this metabolite
|
|||||
| Regulating Pair |
Experim Info
click to show the details of experiment for validating this pair
|
[3] | ||||
| Introduced Variation | Glutamine addition (576 hours) | |||||
| Induced Change | PCK2 protein expression levels: decrease (FC = 1.6) | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Colon cancer [ICD-11: 2B90] | |||||
| Details | It is reported that glutamine addition causes the decrease of PCK2 protein expression compared with control group. | |||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.

