Details of Protein

General Information of Protein (ID: PRT00279)
Name Lipoyl synthase (LIAS)
Synonyms   Click to Show/Hide Synonyms of This Protein
Lipoate synthase; LS; Lip-syn; Lipoic acid synthase; HUSSY-01; LIAS; LAS
Gene Name LIAS Gene ID
11019
UniProt ID
O43766
Family Transferases (EC 2)
EC Number   EC: 2.8.1.8  (Click to Show/Hide the Complete EC Tree)
Transferase
Sulfotransferase
Sulfurtransferase
EC: 2.8.1.8
  Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein
Sequence
MSLRCGDAARTLGPRVFGRYFCSPVRPLSSLPDKKKELLQNGPDLQDFVSGDLADRSTWD
EYKGNLKRQKGERLRLPPWLKTEIPMGKNYNKLKNTLRNLNLHTVCEEARCPNIGECWGG
GEYATATATIMLMGDTCTRGCRFCSVKTARNPPPLDASEPYNTAKAIAEWGLDYVVLTSV
DRDDMPDGGAEHIAKTVSYLKERNPKILVECLTPDFRGDLKAIEKVALSGLDVYAHNVET
VPELQSKVRDPRANFDQSLRVLKHAKKVQPDVISKTSIMLGLGENDEQVYATMKALREAD
VDCLTLGQYMQPTRRHLKVEEYITPEKFKYWEKVGNELGFHYTASGPLVRSSYKAGEFFL
KNLVAKRKTKDL
Function Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.
Regulatory Network
Full List of Metabolite(s) Regulated by This Protein
      Organic acids and derivatives
            2-Hydroxyglutarate Click to Show/Hide the Full List of Regulating Pair(s):   2 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair (1) Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Mutation (R249H) of LIAS
                      Induced Change 2-Hydroxyglutarate concentration: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Cervical Cancer [ICD-11: 2C77]
                      Details It is reported that mutation (R249H) of LIAS leads to the increase of 2-hydroxyglutarate levels compared with control group.
               Regulating Pair (2) Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Knockout of LIAS
                      Induced Change 2-Hydroxyglutarate concentration: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Cervical Cancer [ICD-11: 2C77]
                      Details It is reported that knockout of LIAS leads to the increase of 2-hydroxyglutarate levels compared with control group.
            Citric acid Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Knockout of LIAS
                      Induced Change Citric acid concentration: decrease
                      Summary Introduced Variation         Induced Change 
                      Disease Status Cervical Cancer [ICD-11: 2C77]
                      Details It is reported that knockout of LIAS leads to the decrease of citric acid levels compared with control group.
            Malic acid Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Knockout of LIAS
                      Induced Change Malic acid concentration: decrease
                      Summary Introduced Variation         Induced Change 
                      Disease Status Cervical Cancer [ICD-11: 2C77]
                      Details It is reported that knockout of LIAS leads to the decrease of malic acid levels compared with control group.
            Oxoglutaric acid Click to Show/Hide the Full List of Regulating Pair(s):   2 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair (1) Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Mutation (R249H) of LIAS
                      Induced Change Oxoglutaric acid concentration: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Cervical Cancer [ICD-11: 2C77]
                      Details It is reported that mutation (R249H) of LIAS leads to the increase of oxoglutaric acid levels compared with control group.
               Regulating Pair (2) Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Knockout of LIAS
                      Induced Change Oxoglutaric acid concentration: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Cervical Cancer [ICD-11: 2C77]
                      Details It is reported that knockout of LIAS leads to the increase of oxoglutaric acid levels compared with control group.
            Succinic acid Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Knockout of LIAS
                      Induced Change Succinic acid concentration: decrease
                      Summary Introduced Variation         Induced Change 
                      Disease Status Cervical Cancer [ICD-11: 2C77]
                      Details It is reported that knockout of LIAS leads to the decrease of succinic acid levels compared with control group.
      Organoheterocyclic compounds
            5-Hydroxymethylcytosine Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Knockout of LIAS
                      Induced Change 5-Hydroxymethylcytosine concentration: decrease
                      Summary Introduced Variation         Induced Change 
                      Disease Status Cervical Cancer [ICD-11: 2C77]
                      Details It is reported that knockout of LIAS leads to the decrease of 5-hydroxymethylcytosine levels compared with control group.
References
1 Mitochondrial Protein Lipoylation and the 2-Oxoglutarate Dehydrogenase Complex Controls HIF1 Stability in Aerobic Conditions. Cell Metab. 2016 Nov 8;24(5):740-752.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.