Details of Protein
| General Information of Protein (ID: PRT00274) | |||||
|---|---|---|---|---|---|
| Name | N6-L-threonylcarbamoyladenine synthase (GCP1) | ||||
| Synonyms |
Click to Show/Hide Synonyms of This Protein
Probable tRNA N6-adenosine threonylcarbamoyltransferase, mitochondrial; t(6)A synthase; O-sialoglycoprotein endopeptidase-like protein 1; t(6)A37 threonylcarbamoyladenosine biosynthesis protein OSGEPL1; tRNA threonylcarbamoyladenosine biosynthesis protein OSGEPL1; OSGEPL1
|
||||
| Gene Name | OSGEPL1 | Gene ID | |||
| UniProt ID | |||||
| Family | Transferases (EC 2) | ||||
| EC Number | EC: 2.3.1.234 (Click to Show/Hide the Complete EC Tree) | ||||
| Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein | |||||
| Sequence |
MLILTKTAGVFFKPSKRKVYEFLRSFNFHPGTLFLHKIVLGIETSCDDTAAAVVDETGNV
LGEAIHSQTEVHLKTGGIVPPAAQQLHRENIQRIVQEALSASGVSPSDLSAIATTIKPGL ALSLGVGLSFSLQLVGQLKKPFIPIHHMEAHALTIRLTNKVEFPFLVLLISGGHCLLALV QGVSDFLLLGKSLDIAPGDMLDKVARRLSLIKHPECSTMSGGKAIEHLAKQGNRFHFDIK PPLHHAKNCDFSFTGLQHVTDKIIMKKEKEEGIEKGQILSSAADIAATVQHTMACHLVKR THRAILFCKQRDLLPQNNAVLVASGGVASNFYIRRALEILTNATQCTLLCPPPRLCTDNG IMIAWNGIERLRAGLGILHDIEGIRYEPKCPLGVDISKEVGEASIKVPQLKMEI |
||||
| Function | Required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in mitochondrial tRNAs that read codons beginning with adenine. Probably involved in the transfer of the threonylcarbamoyl moiety of threonylcarbamoyl-AMP (TC-AMP) to the N6 group of A37. Involved in mitochondrial genome maintenance. | ||||
| Regulatory Network | |||||
| Full List of Metabolite(s) Regulating This Protein | ||||||
|---|---|---|---|---|---|---|
| Organic acids and derivatives | ||||||
| Glutamine | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
| Detailed Information |
Metabo Info
click to show the details of this metabolite
|
|||||
| Regulating Pair |
Experim Info
click to show the details of experiment for validating this pair
|
[1] | ||||
| Introduced Variation | Glutamine absence (16 hours) | |||||
| Induced Change | OSGEPL1 protein abundance levels: decrease (FC = 0.53) | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Hepatocellular carcinoma [ICD-11: 2C12] | |||||
| Details | It is reported that glutamine absence causes the decrease of OSGEPL1 protein abundance compared with control group. | |||||
| References | |||||
|---|---|---|---|---|---|
| 1 | Quantitative proteomics analysis reveals glutamine deprivation activates fatty acid -oxidation pathway in HepG2 cells. Amino Acids. 2016 May;48(5):1297-307. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.

