Details of Protein
General Information of Protein (ID: PRT00272) | |||||
---|---|---|---|---|---|
Name | Sulfide quinone oxidoreductase (SQOR) | ||||
Synonyms |
Click to Show/Hide Synonyms of This Protein
SQOR; Sulfide quinone oxidoreductase; Sqor; Sqrdl
|
||||
Gene Name | Sqor | Gene ID | |||
UniProt ID | |||||
Family | Oxidoreductases (EC 1) | ||||
EC Number | EC: 1.8.5.8 (Click to Show/Hide the Complete EC Tree) | ||||
Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein | |||||
Sequence |
MAPLVTVVSSPRARLFACFLRLGTQQAGPLQLHTGACCTAKNHYEVLVLGGGAGGITMAT
RMKRRVGAENVAIVEPSERHFYQPIWTLVGAGAKELSLSVRSTLSVIPSGVQWIQDRVAE LNPDENCIRTDSGKEISYRYLIIALGIQLDYEKIKGLPEGFAYPKIGSNYSVKTVEKTWK ALQGFKEGNALFTFPNTPVKCAGAPQKIMYLSEAYFRKTGKRPKANIIFNTALGTIFGVK KYADALQEIIRERDVSVNYKHNLIEVRPDKQEAVFEILDKPGETHVIPYEMLHVTPPMSA PDVLKRSPVADSAGWVDVDKETLQHKKYPNVFGIGDCTNLPTSKTAAAVAAQSGILDRTM CLIMKNQRPIKKYDGYTSCPLVTGYNRVILAEFDYTAQPLETFPFDQSKERITMYLMKAD MMPFLYWNMMLRGYWGGPAFLRKLFHLGMN |
||||
Function | Catalyzes the oxidation of hydrogen sulfide with the help of a quinone, such as ubiquinone-10, giving rise to thiosulfate and ultimately to sulfane (molecular sulfur) atoms. Requires an additional electron acceptor; can use sulfite, sulfide or cyanide (in vitro). It is believed the in vivo electron acceptor is glutathione. | ||||
Regulatory Network | |||||
Full List of Metabolite(s) Regulating This Protein | ||||||
---|---|---|---|---|---|---|
Organic oxygen compounds | ||||||
Glucose | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
Detailed Information |
Metabo Info
![]() |
|||||
Regulating Pair |
Experim Info
![]() |
[1] | ||||
Introduced Variation | Glucose (low concentration) addition (17.50 hours) | |||||
Induced Change | SQOR protein abundance levels: increase (FC = 2.05) | |||||
Summary | Introduced Variation
![]() ![]() ![]() |
|||||
Disease Status | Cerebral stroke [ICD-11: 8B11] | |||||
Details | It is reported that low glucose addition causes the increase of SQOR protein abundance compared with control group. | |||||
References | |||||
---|---|---|---|---|---|
1 | Quantitative Proteomics Reveals the Beneficial Effects of Low Glucose on Neuronal Cell Survival in an in vitro Ischemic Penumbral Model. Front Cell Neurosci. 2020 Sep 1;14:272. |
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.