Details of Protein
| General Information of Protein (ID: PRT00258) | |||||
|---|---|---|---|---|---|
| Name | Cytokeratin-1 (KRT1) | ||||
| Synonyms |
Click to Show/Hide Synonyms of This Protein
Keratin, type II cytoskeletal 1; 67 kDa cytokeratin; CK-1; Hair alpha protein; Keratin-1; K1; Type-II keratin Kb1; KRT1; KRTA
|
||||
| Gene Name | KRT1 | Gene ID | |||
| UniProt ID | |||||
| Family | Intermediate filament (InFi) | ||||
| Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein | |||||
| Sequence |
MSRQFSSRSGYRSGGGFSSGSAGIINYQRRTTSSSTRRSGGGGGRFSSCGGGGGSFGAGG
GFGSRSLVNLGGSKSISISVARGGGRGSGFGGGYGGGGFGGGGFGGGGFGGGGIGGGGFG GFGSGGGGFGGGGFGGGGYGGGYGPVCPPGGIQEVTINQSLLQPLNVEIDPEIQKVKSRE REQIKSLNNQFASFIDKVRFLEQQNQVLQTKWELLQQVDTSTRTHNLEPYFESFINNLRR RVDQLKSDQSRLDSELKNMQDMVEDYRNKYEDEINKRTNAENEFVTIKKDVDGAYMTKVD LQAKLDNLQQEIDFLTALYQAELSQMQTQISETNVILSMDNNRSLDLDSIIAEVKAQYED IAQKSKAEAESLYQSKYEELQITAGRHGDSVRNSKIEISELNRVIQRLRSEIDNVKKQIS NLQQSISDAEQRGENALKDAKNKLNDLEDALQQAKEDLARLLRDYQELMNTKLALDLEIA TYRTLLEGEESRMSGECAPNVSVSVSTSHTTISGGGSRGGGGGGYGSGGSSYGSGGGSYG SGGGGGGGRGSYGSGGSSYGSGGGSYGSGGGGGGHGSYGSGSSSGGYRGGSGGGGGGSSG GRGSGGGSSGGSIGGRGSSSGGVKSSGGSSSVKFVSTTYSGVTR |
||||
| Structure | |||||
| Function | May regulate the activity of kinases such as PKC and SRC via binding to integrin beta-1 (ITB1) and the receptor of activated protein C kinase 1 (RACK1). In complex with C1QBP is a high affinity receptor for kininogen-1/HMWK. | ||||
| Regulatory Network | |||||
| Full List of Metabolite(s) Regulating This Protein | ||||||
|---|---|---|---|---|---|---|
| Organic acids and derivatives | ||||||
| Oxoglutaric acid | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
| Detailed Information |
Metabo Info
click to show the details of this metabolite
|
|||||
| Regulating Pair |
Experim Info
click to show the details of experiment for validating this pair
|
[1] | ||||
| Introduced Variation | Oxoglutaric acid addition (336 hours) | |||||
| Induced Change | KRT1 protein expression levels: increase | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Parkinsonism [ICD-11: 8A00] | |||||
| Details | It is reported that oxoglutaric acid addition causes the increase of KRT1 protein expression compared with control group. | |||||
| References | |||||
|---|---|---|---|---|---|
| 1 | Dietary keto-acid feed-back on pituitary activity in gilthead sea bream: effects of oral doses of AKG. A proteomic approach. Gen Comp Endocrinol. 2010 Dec 1;169(3):284-92. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.

