Details of Protein
| General Information of Protein (ID: PRT00244) | |||||
|---|---|---|---|---|---|
| Name | Hypusine-containing protein HP2 (HYP2) | ||||
| Synonyms |
Click to Show/Hide Synonyms of This Protein
eIF-5A-1; Hypusine-containing protein HP2; eIF-4D; YEL034W; SYGP-ORF21; HYP2; TIF51A
|
||||
| Gene Name | HYP2 | Gene ID | |||
| UniProt ID | |||||
| Family | Translation initiation factor (TIF) | ||||
| Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein | |||||
| Sequence |
MSDEEHTFETADAGSSATYPMQCSALRKNGFVVIKSRPCKIVDMSTSKTGKHGHAKVHLV
AIDIFTGKKLEDLSPSTHNMEVPVVKRNEYQLLDIDDGFLSLMNMDGDTKDDVKAPEGEL GDSLQTAFDEGKDLMVTIISAMGEEAAISFKEAARTD |
||||
| Structure | |||||
| Function | mRNA-binding protein involved in translation elongation. Has an important function at the level of mRNA turnover, probably acting downstream of decapping. Involved in actin dynamics and cell cycle progression, mRNA decay and probably in a pathway involved in stress response and maintenance of cell wall integrity. Essential for polarized growth, a process necessary for G1/S transition. May mediate large range of effects of the polyamine spermidine in the cell. | ||||
| Regulatory Network | |||||
| Full List of Metabolite(s) Regulating This Protein | ||||||
|---|---|---|---|---|---|---|
| Organic oxygen compounds | ||||||
| Glucose | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
| Detailed Information |
Metabo Info
click to show the details of this metabolite
|
|||||
| Regulating Pair |
Experim Info
click to show the details of experiment for validating this pair
|
[1] | ||||
| Introduced Variation | Glucose addition (1.50 hours) | |||||
| Induced Change | HYP2 protein expression levels: increase | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Healthy individual | |||||
| Details | It is reported that glucose addition causes the increase of HYP2 protein expression compared with control group. | |||||
| References | |||||
|---|---|---|---|---|---|
| 1 | Proteome analysis of yeast response to various nutrient limitations. Mol Syst Biol. 2006;2:2006.0026. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.

