Details of Protein

General Information of Protein (ID: PRT00244)
Name Hypusine-containing protein HP2 (HYP2)
Synonyms   Click to Show/Hide Synonyms of This Protein
eIF-5A-1; Hypusine-containing protein HP2; eIF-4D; YEL034W; SYGP-ORF21; HYP2; TIF51A
Gene Name HYP2 Gene ID
856677
UniProt ID
P23301
Family Translation initiation factor (TIF)
  Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein
Sequence
MSDEEHTFETADAGSSATYPMQCSALRKNGFVVIKSRPCKIVDMSTSKTGKHGHAKVHLV
AIDIFTGKKLEDLSPSTHNMEVPVVKRNEYQLLDIDDGFLSLMNMDGDTKDDVKAPEGEL
GDSLQTAFDEGKDLMVTIISAMGEEAAISFKEAARTD
Structure
3ER0 ; 5DAT ; 5DC3 ; 5DGE ; 5DGF ; 5GAK ; 5MC6 ; 6Q84 ; 6TNU
Function mRNA-binding protein involved in translation elongation. Has an important function at the level of mRNA turnover, probably acting downstream of decapping. Involved in actin dynamics and cell cycle progression, mRNA decay and probably in a pathway involved in stress response and maintenance of cell wall integrity. Essential for polarized growth, a process necessary for G1/S transition. May mediate large range of effects of the polyamine spermidine in the cell.
Regulatory Network
Full List of Metabolite(s) Regulating This Protein
      Organic oxygen compounds
            Glucose Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Glucose addition (1.50 hours)
                      Induced Change HYP2 protein expression levels: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that glucose addition causes the increase of HYP2 protein expression compared with control group.
References
1 Proteome analysis of yeast response to various nutrient limitations. Mol Syst Biol. 2006;2:2006.0026.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.