Details of Protein

General Information of Protein (ID: PRT00242)
Name Superoxide dismutase copper chaperone (CCS)
Synonyms   Click to Show/Hide Synonyms of This Protein
Copper chaperone for superoxide dismutase; Ccs; Ccsd
Gene Name Ccs Gene ID
12460
UniProt ID
Q9WU84
Family Oxidoreductases (EC 1)
  Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein
Sequence
MASKSGDGGTVCALEFAVQMSCQSCVDAVHKTLKGVAGVQNVDVQLENQMVLVQTTLPSQ
EVQALLESTGRQAVLKGMGSSQLQNLGAAVAILEGCGSIQGVVRFLQLSSELCLIEGTID
GLEPGLHGLHVHQYGDLTRDCNSCGDHFNPDGASHGGPQDTDRHRGDLGNVRAEAGGRAT
FRIEDKQLKVWDVIGRSLVIDEGEDDLGRGGHPLSKITGNSGKRLACGIIARSAGLFQNP
KQICSCDGLTIWEERGRPIAGQGRKDSAQPPAHL
Function Delivers copper to copper zinc superoxide dismutase (SOD1).
Regulatory Network
Full List of Metabolite(s) Regulating This Protein
      Organic acids and derivatives
            Methionine Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Methionine addition (5 hours)
                      Induced Change CCS protein expression levels: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Hyperhomocysteinaemia [ICD-11: 3B61]
                      Details It is reported that methionine addition causes the increase of CCS protein expression compared with control group.
References
1 Regulatory cross-talk of mouse liver polyamine and methionine metabolic pathways: a systemic approach to its physiopathological consequences. Amino Acids. 2012 Feb;42(2-3):577-95.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.