Details of Protein

General Information of Protein (ID: PRT00239)
Name Rho GDP-dissociation inhibitor 1 (ARHGDIA)
Synonyms   Click to Show/Hide Synonyms of This Protein
Rho GDI 1; GDI-1; Rho-GDI alpha; Arhgdia; C87222; Gdi1
Gene Name Arhgdia Gene ID
192662
UniProt ID
Q99PT1
Family Rho-GDP dissociation inhibitor (RGDI)
  Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein
Sequence
MAEQEPTAEQLAQIAAENEEDEHSVNYKPPAQKSIQEIQELDKDDESLRKYKEALLGRVA
VSADPNVPNVIVTRLTLVCSTAPGPLELDLTGDLESFKKQSFVLKEGVEYRIKISFRVNR
EIVSGMKYIQHTYRKGVKIDKTDYMVGSYGPRAEEYEFLTPMEEAPKGMLARGSYNIKSR
FTDDDKTDHLSWEWNLTIKKEWKD
Structure
4F38
Function Controls Rho proteins homeostasis. Regulates the GDP/GTP exchange reaction of the Rho proteins by inhibiting the dissociation of GDP from them, and the subsequent binding of GTP to them. Retains Rho proteins such as CDC42, RAC1 and RHOA in an inactive cytosolic pool, regulating their stability and protecting them from degradation. Actively involved in the recycling and distribution of activated Rho GTPases in the cell, mediates extraction from membranes of both inactive and activated molecules due its exceptionally high affinity for prenylated forms. Through the modulation of Rho proteins, may play a role in cell motility regulation. In glioma cells, inhibits cell migration and invasion by mediating the signals of SEMA5A and PLXNB3 that lead to inactivation of RAC1.
Regulatory Network
Full List of Metabolite(s) Regulating This Protein
      Organic acids and derivatives
            Methionine Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Methionine decrease (504 hours)
                      Induced Change ARHGDIA protein expression levels: increase (FC = 1.80)
                      Summary Introduced Variation         Induced Change 
                      Disease Status Fatty liver disease [ICD-11: DB92]
                      Details It is reported that methionine decrease causes the increase of ARHGDIA protein expression compared with control group.
References
1 Proteomic analysis of mice fed methionine and choline deficient diet reveals marker proteins associated with steatohepatitis. PLoS One. 2015 Apr 7;10(4):e0120577.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.