Details of Protein
| General Information of Protein (ID: PRT00238) | |||||
|---|---|---|---|---|---|
| Name | Protease B inhibitor 2 (PBI2) | ||||
| Synonyms |
Click to Show/Hide Synonyms of This Protein
Proteinase inhibitor I(B)2; YNL015W; N2844; PBI2
|
||||
| Gene Name | PBI2 | Gene ID | |||
| UniProt ID | |||||
| Family | Protease inhibitor I9 (I9) | ||||
| Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein | |||||
| Sequence |
MTKNFIVTLKKNTPDVEAKKFLDSVHHAGGSIVHEFDIIKGYTIKVPDVLHLNKLKEKHN
DVIENVEEDKEVHTN |
||||
| Function | Cytosolic inhibitor of vacuolar proteinase B (yscB), probably regulating protease B activity during limited proteolysis. PBI2 is a component of the LMA1 complex, which is involved in the facilitation of vesicle fusion such as homotypic vacuole and ER-derived COPII vesicle fusion with the Golgi. | ||||
| Regulatory Network | |||||
| Full List of Metabolite(s) Regulating This Protein | ||||||
|---|---|---|---|---|---|---|
| Organic oxygen compounds | ||||||
| Glucose | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
| Detailed Information |
Metabo Info
 click to show the details of this metabolite
|
|||||
| Regulating Pair |
Experim Info
click to show the details of experiment for validating this pair
|
[1] | ||||
| Introduced Variation | Glucose addition (1.50 hours) | |||||
| Induced Change | PBI2 protein expression levels: increase | |||||
| Summary | Introduced Variation
Induced Change
|
|||||
| Disease Status | Healthy individual | |||||
| Details | It is reported that glucose addition causes the increase of PBI2 protein expression compared with control group. | |||||
| References | |||||
|---|---|---|---|---|---|
| 1 | Proteome analysis of yeast response to various nutrient limitations. Mol Syst Biol. 2006;2:2006.0026. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.