Details of Protein

General Information of Protein (ID: PRT00236)
Name Phosphatidylethanolamine-binding 1 (PEBP1)
Synonyms   Click to Show/Hide Synonyms of This Protein
PEBP-1; HCNPpp; Pebp1; Pbp; Pebp
Gene Name Pebp1 Gene ID
23980
UniProt ID
P70296
Family Phosphatidylethanolamine-binding (PAB)
  Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein
Sequence
MAADISQWAGPLCLQEVDEPPQHALRVDYAGVTVDELGKVLTPTQVMNRPSSISWDGLDP
GKLYTLVLTDPDAPSRKDPKFREWHHFLVVNMKGNDISSGTVLSDYVGSGPPSGTGLHRY
VWLVYEQEQPLSCDEPILSNKSGDNRGKFKVETFRKKYNLGAPVAGTCYQAEWDDYVPKL
YEQLSGK
Structure
6ENS
Function Binds ATP, opioids and phosphatidylethanolamine. Has lower affinity for phosphatidylinositol and phosphatidylcholine. Serine protease inhibitor which inhibits thrombin, neuropsin and chymotrypsin but not trypsin, tissue type plasminogen activator and elastase. Inhibits the kinase activity of RAF1 by inhibiting its activation and by dissociating the RAF1/MEK complex and acting as a competitive inhibitor of MEK phosphorylation.; HCNP may be involved in the function of the presynaptic cholinergic neurons of the central nervous system. HCNP increases the production of choline acetyltransferase but not acetylcholinesterase. Seems to be mediated by a specific receptor.
Regulatory Network
Full List of Metabolite(s) Regulating This Protein
      Organic acids and derivatives
            Methionine Click to Show/Hide the Full List of Regulating Pair(s):   2 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair (1) Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Methionine addition (336 hours)
                      Induced Change PEBP1 protein expression levels: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Hyperhomocysteinaemia [ICD-11: 3B61]
                      Details It is reported that methionine addition causes the increase of PEBP1 protein expression compared with control group.
               Regulating Pair (2) Experim Info click to show the details of experiment for validating this pair [2]
                      Introduced Variation Methionine decrease (504 hours)
                      Induced Change PEBP1 protein expression levels: decrease (FC = 0.58)
                      Summary Introduced Variation         Induced Change 
                      Disease Status Fatty liver disease [ICD-11: DB92]
                      Details It is reported that methionine decrease causes the decrease of PEBP1 protein expression compared with control group.
References
1 The nutrigenetics of hyperhomocysteinemia: quantitative proteomics reveals differences in the methionine cycle enzymes of gene-induced versus diet-induced hyperhomocysteinemia. Mol Cell Proteomics. 2010 Mar;9(3):471-85.
2 Proteomic analysis of mice fed methionine and choline deficient diet reveals marker proteins associated with steatohepatitis. PLoS One. 2015 Apr 7;10(4):e0120577.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.