Details of Protein

General Information of Protein (ID: PRT00234)
Name Nuclear transport factor 2 (NTF2)
Synonyms   Click to Show/Hide Synonyms of This Protein
NTF-2; Nuclear transport factor P10; YER009W; NTF2
Gene Name NTF2 Gene ID
856727
UniProt ID
P33331
Family Nuclear transport factor (NTF)
  Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein
Sequence
MSLDFNTLAQNFTQFYYNQFDTDRSQLGNLYRNESMLTFETSQLQGAKDIVEKLVSLPFQ
KVQHRITTLDAQPASPNGDVLVMITGDLLIDEEQNPQRFSQVFHLIPDGNSYYVFNDIFR
LNYSA
Structure
1GY7 ; 1GYB
Function Facilitates protein transport into the nucleus. Interacts with various nucleoporins and with Ran-GDP. Could be part of a multicomponent system of cytosolic factors that assemble at the pore complex during nuclear import. In vitro, the NTF2-Ran-GDP association, in the presence of GTP, triggers dissociation of the karyopherin alpha-beta complex, allowing nuclear translocation of karyopherin alpha and the NLS substrate.
Regulatory Network
Full List of Metabolite(s) Regulating This Protein
      Homogeneous non-metal compounds
            Nitrogen Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Nitrogen limitation (1.50 hours)
                      Induced Change NTF2 protein expression levels: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that nitrogen limitation causes the increase of NTF2 protein expression compared with control group.
References
1 Proteome analysis of yeast response to various nutrient limitations. Mol Syst Biol. 2006;2:2006.0026.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.