Details of Protein
| General Information of Protein (ID: PRT00229) | |||||
|---|---|---|---|---|---|
| Name | Glutaredoxin-8 (GRX8) | ||||
| Synonyms |
Click to Show/Hide Synonyms of This Protein
Glutathione-dependent oxidoreductase 8; YLR364W; GRX8
|
||||
| Gene Name | GRX8 | Gene ID | |||
| UniProt ID | |||||
| Family | Glutaredoxin (GluD) | ||||
| Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein | |||||
| Sequence |
MSAFVTKAEEMIKSHPYFQLSASWCPDCVYANSIWNKLNVQDKVFVFDIGSLPRNEQEKW
RIAFQKVVGSRNLPTIVVNGKFWGTESQLHRFEAKGTLEEELTKIGLLP |
||||
| Structure | |||||
| Function | Glutathione-dependent oxidoreductase with lower activity compared to the other members of the glutaredoxin family. The disulfide bond functions as an electron carrier in the glutathione-dependent synthesis of deoxyribonucleotides by the enzyme ribonucleotide reductase. | ||||
| Regulatory Network | |||||
| Full List of Metabolite(s) Regulating This Protein | ||||||
|---|---|---|---|---|---|---|
| Homogeneous non-metal compounds | ||||||
| Nitrogen | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
| Detailed Information |
Metabo Info
 click to show the details of this metabolite
|
|||||
| Regulating Pair |
Experim Info
click to show the details of experiment for validating this pair
|
[1] | ||||
| Introduced Variation | Nitrogen limitation (1.50 hours) | |||||
| Induced Change | GRX8 protein expression levels: increase | |||||
| Summary | Introduced Variation
Induced Change
|
|||||
| Disease Status | Healthy individual | |||||
| Details | It is reported that nitrogen limitation causes the increase of GRX8 protein expression compared with control group. | |||||
| References | |||||
|---|---|---|---|---|---|
| 1 | Proteome analysis of yeast response to various nutrient limitations. Mol Syst Biol. 2006;2:2006.0026. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.