Details of Protein

General Information of Protein (ID: PRT00228)
Name	Signal recognition particle 9 kDa protein (SRP9)
Synonyms	Click to Show/Hide Synonyms of This Protein SRP9; SRP9
Gene Name	SRP9	Gene ID	6726
UniProt ID	P49458
Family	General secretory pathway (SEC)
TC Number	TC: 3.A.5.9.1 (Click to Show/Hide the Complete TC Tree) The General Secretory Pathway (Sec) Family . TC: 3.A.5.9.1
	*Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein*
Sequence	MPQYQTWEEFSRAAEKLYLADPMKARVVLKYRHSDGNLCVKVTDDLVCLVYKTDQAQDVK KIEKFHSQLMRLMVAKEARNVTMETE
Structure	1E8O ; 1E8S ; 1RY1 ; 4UYJ ; 4UYK ; 5AOX
Function	Signal-recognition-particle assembly has a crucial role in targeting secretory proteins to the rough endoplasmic reticulum membrane. SRP9 together with SRP14 and the Alu portion of the SRP RNA, constitutes the elongation arrest domain of SRP. The complex of SRP9 and SRP14 is required for SRP RNA binding.
Regulatory Network
Regulatory Network

Full List of Metabolite(s) Regulating This Protein
Organic acids and derivatives
Glutamine		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Glutamine absence (16 hours)
Induced Change	SRP9 protein abundance levels: decrease (FC = 0.77)
Summary	Introduced Variation Induced Change
Disease Status	Hepatocellular carcinoma [ICD-11: 2C12]
Details	It is reported that glutamine absence causes the decrease of SRP9 protein abundance compared with control group.

References
1	Quantitative proteomics analysis reveals glutamine deprivation activates fatty acid -oxidation pathway in HepG2 cells. Amino Acids. 2016 May;48(5):1297-307.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.