Details of Protein
General Information of Protein (ID: PRT00227) | |||||
---|---|---|---|---|---|
Name | Fatty acid-binding protein 1 (FABP1) | ||||
Synonyms |
Click to Show/Hide Synonyms of This Protein
14 kDa selenium-binding protein; Fatty acid-binding protein 1; Liver-type fatty acid-binding protein; L-FABP; Fabp1; Fabpl
|
||||
Gene Name | Fabp1 | Gene ID | |||
UniProt ID | |||||
Family | Fatty acid binding protein (FABP) | ||||
Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein | |||||
Sequence |
MNFSGKYQLQSQENFEPFMKAIGLPEDLIQKGKDIKGVSEIVHEGKKIKLTITYGPKVVR
NEFTLGEECELETMTGEKVKAVVKLEGDNKMVTTFKGIKSVTELNGDTITNTMTLGDIVY KRVSKRI |
||||
Function | Plays a role in lipoprotein-mediated cholesterol uptake in hepatocytes. Binds cholesterol. Binds free fatty acids and their coenzyme A derivatives, bilirubin, and some other small molecules in the cytoplasm. May be involved in intracellular lipid transport. | ||||
Regulatory Network | |||||
Full List of Metabolite(s) Regulating This Protein | ||||||
---|---|---|---|---|---|---|
Organic acids and derivatives | ||||||
Methionine | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
Detailed Information |
Metabo Info
![]() |
|||||
Regulating Pair |
Experim Info
![]() |
[1] | ||||
Introduced Variation | Methionine addition (336 hours) | |||||
Induced Change | FABP1 protein expression levels: decrease | |||||
Summary | Introduced Variation
![]() ![]() ![]() |
|||||
Disease Status | Hyperhomocysteinaemia [ICD-11: 3B61] | |||||
Details | It is reported that methionine addition causes the decrease of FABP1 protein expression compared with control group. | |||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.