Details of Protein

General Information of Protein (ID: PRT00226)
Name Fatty acid-binding protein 1 (FABP1)
Synonyms   Click to Show/Hide Synonyms of This Protein
Fatty acid-binding protein 1; Liver-type fatty acid-binding protein; L-FABP; FABP1; FABPL
Gene Name FABP1 Gene ID
2168
UniProt ID
P07148
Family Fatty acid binding protein (FABP)
  Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein
Sequence
MSFSGKYQLQSQENFEAFMKAIGLPEELIQKGKDIKGVSEIVQNGKHFKFTITAGSKVIQ
NEFTVGEECELETMTGEKVKTVVQLEGDNKLVTTFKNIKSVTELNGDIITNTMTLGDIVF
KRISKRI
Structure
2F73 ; 2L67 ; 2L68 ; 2LKK ; 2PY1 ; 3B2H ; 3B2I ; 3B2J ; 3B2K ; 3B2L ; 3STK ; 3STM ; 3STN ; 3VG2 ; 3VG3 ; 3VG4 ; 3VG5 ; 3VG6 ; 3VG7 ; 6DO6 ; 6DO7 ; 6DRG ; 6MP4
Function Plays a role in lipoprotein-mediated cholesterol uptake in hepatocytes. Binds cholesterol. Binds free fatty acids and their coenzyme A derivatives, bilirubin, and some other small molecules in the cytoplasm. May be involved in intracellular lipid transport.
Regulatory Network
Full List of Metabolite(s) Regulating This Protein
      Organic acids and derivatives
            Glutamine Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Glutamine addition (5 hours)
                      Induced Change FABP1 protein expression levels: decrease
                      Summary Introduced Variation         Induced Change 
                      Disease Status Inflammatory bowel disease [ICD-11: DD72]
                      Details It is reported that glutamine addition causes the decrease of FABP1 protein expression compared with control group.
            Leucine Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [2]
                      Introduced Variation Leucine addition (5 hours)
                      Induced Change FABP1 protein expression levels: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that leucine addition causes the increase of FABP1 protein expression compared with control group.
References
1 Human duodenal proteome modulations by glutamine and antioxidants. Proteomics Clin Appl. 2010 Mar;4(3):325-36.
2 An enteral leucine supply modulates human duodenal mucosal proteome and decreases the expression of enzymes involved in fatty acid beta-oxidation. J Proteomics. 2013 Jan 14;78:535-44.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.