Details of Protein

General Information of Protein (ID: PRT00225)
Name Cystatin-A (CSTA)
Synonyms   Click to Show/Hide Synonyms of This Protein
S; Stefin-A; CSTA; STF1; STFA
Gene Name CSTA Gene ID
1475
UniProt ID
P01040
Family Cystatin (Cyst)
  Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein
Sequence
MIPGGLSEAKPATPEIQEIVDKVKPQLEEKTNETYGKLEAVQYKTQVVAGTNYYIKVRAG
DNKYMHLKVFKSLPGQNEDLVLTGYQVDKNKDDELTGF
Structure
1CYU ; 1CYV ; 1DVC ; 1DVD ; 1GD3 ; 1GD4 ; 1N9J ; 1NB3 ; 1NB5 ; 3K9M ; 3KFQ ; 3KSE
Function This is an intracellular thiol proteinase inhibitor. Has an important role in desmosome-mediated cell-cell adhesion in the lower levels of the epidermis.
Regulatory Network
Full List of Metabolite(s) Regulating This Protein
      Organic acids and derivatives
            Glutamine Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Glutamine addition (12 hours)
                      Induced Change CSTA protein expression levels: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Inflammatory bowel disease [ICD-11: DD72]
                      Details It is reported that glutamine addition causes the increase of CSTA protein expression compared with control group.
References
1 Proteomic analysis of glutamine-treated human intestinal epithelial HCT-8 cells under basal and inflammatory conditions. Proteomics. 2006 Jul;6(13):3926-37.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.