General Information of Protein (ID: PRT00224)
Name COMM domain-containing protein 2 (COMMD2)
Synonyms   Click to Show/Hide Synonyms of This Protein
HSPC042; My004; COMMD2
Gene Name COMMD2 Gene ID
51122
UniProt ID
Q86X83
Family COMM domain containing (COMM)
  Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein
Sequence
MLLELSEEHKEHLAFLPQVDSAVVAEFGRIAVEFLRRGANPKIYEGAARKLNVSSDTVQH
GVEGLTYLLTESSKLMISELDFQDSVFVLGFSEELNKLLLQLYLDNRKEIRTILSELAPS
LPSYHNLEWRLDVQLASRSLRQQIKPAVTIKLHLNQNGDHNTKVLQTDPATLLHLVQQLE
QALEEMKTNHCRRVVRNIK
Function May modulate activity of cullin-RING E3 ubiquitin ligase (CRL) complexes. May down-regulate activation of NF-kappa-B.
Regulatory Network
Full List of Metabolite(s) Regulating This Protein
      Organic acids and derivatives
            Glutamine Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Glutamine addition (24 hours)
                      Induced Change COMMD2 protein expression levels: decrease
                      Summary Introduced Variation         Induced Change 
                      Disease Status Colon cancer [ICD-11: 2B90]
                      Details It is reported that glutamine addition causes the decrease of COMMD2 protein expression compared with control group.
References
1 Glutamine regulates the human epithelial intestinal HCT-8 cell proteome under apoptotic conditions. Mol Cell Proteomics. 2007 Oct;6(10):1671-9.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.