Details of Protein

General Information of Protein (ID: PRT00221)
Name Hsp90 co-chaperone Cdc37 (CDC37)
Synonyms   Click to Show/Hide Synonyms of This Protein
Hsp90 chaperone protein kinase-targeting subunit; p50Cdc37; CDC37; CDC37A
Gene Name CDC37 Gene ID
11140
UniProt ID
Q16543
Family Chaperone protein (ChaP)
  Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein
Sequence
MVDYSVWDHIEVSDDEDETHPNIDTASLFRWRHQARVERMEQFQKEKEELDRGCRECKRK
VAECQRKLKELEVAEGGKAELERLQAEAQQLRKEERSWEQKLEEMRKKEKSMPWNVDTLS
KDGFSKSMVNTKPEKTEEDSEEVREQKHKTFVEKYEKQIKHFGMLRRWDDSQKYLSDNVH
LVCEETANYLVIWCIDLEVEEKCALMEQVAHQTIVMQFILELAKSLKVDPRACFRQFFTK
IKTADRQYMEGFNDELEAFKERVRGRAKLRIEKAMKEYEEEERKKRLGPGGLDPVEVYES
LPEELQKCFDVKDVQMLQDAISKMDPTDAKYHMQRCIDSGLWVPNSKASEAKEGEEAGPG
DPLLEAVPKTGDEKDVSV
Structure
1US7 ; 2K5B ; 2N5X ; 2NCA ; 2W0G ; 5FWK ; 5FWL ; 5FWM ; 5FWP ; 5HPE
Function Co-chaperone that binds to numerous kinases and promotes their interaction with the Hsp90 complex, resulting in stabilization and promotion of their activity. Inhibits HSP90AA1 ATPase activity.
Regulatory Network
Full List of Metabolite(s) Regulating This Protein
      Organic oxygen compounds
            Glucose Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Glucose addition (16 hours)
                      Induced Change CDC37 protein expression levels: decrease
                      Summary Introduced Variation         Induced Change 
                      Disease Status Hyperglycemic hyperosmolar syndrome [ICD-11: 5A20]
                      Details It is reported that glucose decrease causes the increase of PKLR protein expression compared with control group.
            Mannitol Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Mannitol addition (16 hours)
                      Induced Change CDC37 protein expression levels: decrease
                      Summary Introduced Variation         Induced Change 
                      Disease Status Hyperglycemic hyperosmolar syndrome [ICD-11: 5A20]
                      Details It is reported that mannitol addition causes the decrease of CDC37 protein expression compared with control group.
References
1 High-glucose-induced changes in macrophage secretome: regulation of immune response. Mol Cell Biochem. 2019 Feb;452(1-2):51-62.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.