Details of Protein
| General Information of Protein (ID: PRT00215) | |||||
|---|---|---|---|---|---|
| Name | Glutamate decarboxylase (GLUL) | ||||
| Synonyms |
Click to Show/Hide Synonyms of This Protein
GS; Glutamate--ammonia ligase; YPR035W; YP3085.01; YP9367.15; GLN1
|
||||
| Gene Name | GLN1 | Gene ID | |||
| UniProt ID | |||||
| Family | Ligases (EC 6) | ||||
| EC Number | EC: 6.3.1.2 (Click to Show/Hide the Complete EC Tree) | ||||
| Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein | |||||
| Sequence |
MAEASIEKTQILQKYLELDQRGRIIAEYVWIDGTGNLRSKGRTLKKRITSIDQLPEWNFD
GSSTNQAPGHDSDIYLKPVAYYPDPFRRGDNIVVLAACYNNDGTPNKFNHRHEAAKLFAA HKDEEIWFGLEQEYTLFDMYDDVYGWPKGGYPAPQGPYYCGVGAGKVYARDMIEAHYRAC LYAGLEISGINAEVMPSQWEFQVGPCTGIDMGDQLWMARYFLHRVAEEFGIKISFHPKPL KGDWNGAGCHTNVSTKEMRQPGGMKYIEQAIEKLSKRHAEHIKLYGSDNDMRLTGRHETA SMTAFSSGVANRGSSIRIPRSVAKEGYGYFEDRRPASNIDPYLVTGIMCETVCGAIDNAD MTKEFERESS |
||||
| Structure | |||||
| Regulatory Network | |||||
| Full List of Metabolite(s) Regulating This Protein | ||||||
|---|---|---|---|---|---|---|
| Homogeneous non-metal compounds | ||||||
| Nitrogen | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
| Detailed Information |
Metabo Info
click to show the details of this metabolite
|
|||||
| Regulating Pair |
Experim Info
click to show the details of experiment for validating this pair
|
[1] | ||||
| Introduced Variation | Nitrogen limitation (1.50 hours) | |||||
| Induced Change | GLN1 protein expression levels: increase | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Healthy individual | |||||
| Details | It is reported that nitrogen limitation causes the increase of GLN1 protein expression compared with control group. | |||||
| References | |||||
|---|---|---|---|---|---|
| 1 | Proteome analysis of yeast response to various nutrient limitations. Mol Syst Biol. 2006;2:2006.0026. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.

