Details of Protein
| General Information of Protein (ID: PRT00213) | |||||
|---|---|---|---|---|---|
| Name | Phenylalanine-tRNA ligase beta (FARSB) | ||||
| Synonyms |
Click to Show/Hide Synonyms of This Protein
Phenylalanyl-tRNA synthetase beta subunit; PheRS; HSPC173; FARSB; FARSLB; FRSB
|
||||
| Gene Name | FARSB | Gene ID | |||
| UniProt ID | |||||
| Family | Ligases (EC 6) | ||||
| EC Number | EC: 6.1.1.20 (Click to Show/Hide the Complete EC Tree) | ||||
| Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein | |||||
| Sequence |
MPTVSVKRDLLFQALGRTYTDEEFDELCFEFGLELDEITSEKEIISKEQGNVKAAGASDV
VLYKIDVPANRYDLLCLEGLVRGLQVFKERIKAPVYKRVMPDGKIQKLIITEETAKIRPF AVAAVLRNIKFTKDRYDSFIELQEKLHQNICRKRALVAIGTHDLDTLSGPFTYTAKRPSD IKFKPLNKTKEYTACELMNIYKTDNHLKHYLHIIENKPLYPVIYDSNGVVLSMPPIINGD HSRITVNTRNIFIECTGTDFTKAKIVLDIIVTMFSEYCENQFTVEAAEVVFPNGKSHTFP ELAYRKEMVRADLINKKVGIRETPENLAKLLTRMYLKSEVIGDGNQIEIEIPPTRADIIH ACDIVEDAAIAYGYNNIQMTLPKTYTIANQFPLNKLTELLRHDMAAAGFTEALTFALCSQ EDIADKLGVDISATKAVHISNPKTAEFQVARTTLLPGLLKTIAANRKMPLPLKLFEISDI VIKDSNTDVGAKNYRHLCAVYYNKNPGFEIIHGLLDRIMQLLDVPPGEDKGGYVIKASEG PAFFPGRCAEIFARGQSVGKLGVLHPDVITKFELTMPCSSLEINVGPFL |
||||
| Structure | |||||
| Regulatory Network | |||||
| Full List of Metabolite(s) Regulating This Protein | ||||||
|---|---|---|---|---|---|---|
| Organic oxygen compounds | ||||||
| Glucose | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
| Detailed Information |
Metabo Info
click to show the details of this metabolite
|
|||||
| Regulating Pair |
Experim Info
click to show the details of experiment for validating this pair
|
[1] | ||||
| Introduced Variation | Glucose addition (16 hours) | |||||
| Induced Change | FARSB protein expression levels: increase (FC = 4) | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Hyperglycemic hyperosmolar syndrome [ICD-11: 5A20] | |||||
| Details | It is reported that glucose addition causes the increase of FARSB protein expression compared with control group. | |||||
| Mannitol | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
| Detailed Information |
Metabo Info
click to show the details of this metabolite
|
|||||
| Regulating Pair |
Experim Info
click to show the details of experiment for validating this pair
|
[1] | ||||
| Introduced Variation | Mannitol addition (16 hours) | |||||
| Induced Change | FARSB protein expression levels: increase | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Hyperglycemic hyperosmolar syndrome [ICD-11: 5A20] | |||||
| Details | It is reported that mannitol addition causes the increase of FARSB protein expression compared with control group. | |||||
| References | |||||
|---|---|---|---|---|---|
| 1 | High-glucose-induced changes in macrophage secretome: regulation of immune response. Mol Cell Biochem. 2019 Feb;452(1-2):51-62. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.

