Details of Protein

General Information of Protein (ID: PRT00207)
Name Triosephosphate isomerase (TPI1)
Synonyms   Click to Show/Hide Synonyms of This Protein
TIM; Methylglyoxal synthase; Triose-phosphate isomerase; TPI1; TPI
Gene Name TPI1 Gene ID
7167
UniProt ID
P60174
Family Isomerases (EC 5)
EC Number   EC: 5.3.1.1  (Click to Show/Hide the Complete EC Tree)
Isomerase
Intramolecular oxidoreductase
Aldose/ketose isomerase
EC: 5.3.1.1
  Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein
Sequence
MAPSRKFFVGGNWKMNGRKQSLGELIGTLNAAKVPADTEVVCAPPTAYIDFARQKLDPKI
AVAAQNCYKVTNGAFTGEISPGMIKDCGATWVVLGHSERRHVFGESDELIGQKVAHALAE
GLGVIACIGEKLDEREAGITEKVVFEQTKVIADNVKDWSKVVLAYEPVWAIGTGKTATPQ
QAQEVHEKLRGWLKSNVSDAVAQSTRIIYGGSVTGATCKELASQPDVDGFLVGGASLKPE
FVDIINAKQ
Structure
1HTI ; 1KLG ; 1KLU ; 1WYI ; 2IAM ; 2IAN ; 2JK2 ; 2VOM ; 4BR1 ; 4E41 ; 4POC ; 4POD ; 4UNK ; 4UNL ; 4ZVJ ; 6C2G ; 6D43 ; 6NLH ; 6UP1 ; 6UP5 ; 6UP8 ; 6UPF
Function Triosephosphate isomerase is an extremely efficient metabolic enzyme that catalyzes the interconversion between dihydroxyacetone phosphate (DHAP) and D-glyceraldehyde-3-phosphate (G3P) in glycolysis and gluconeogenesis.; It is also responsible for the non-negligible production of methylglyoxal a reactive cytotoxic side-product that modifies and can alter proteins, DNA and lipids.
Regulatory Network
Full List of Metabolite(s) Regulating This Protein
      Organic acids and derivatives
            Arginine Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Arginine decrease (48 hours)
                      Induced Change TPI1 protein abundance levels: increase (FC = 1.8)
                      Summary Introduced Variation         Induced Change 
                      Disease Status Colon cancer [ICD-11: 2B90]
                      Details It is reported that arginine decrease causes the increase of TPI1 protein abundance compared with control group.
            Glutamine Click to Show/Hide the Full List of Regulating Pair(s):   2 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair (1) Experim Info click to show the details of experiment for validating this pair [2]
                      Introduced Variation Glutamine addition (12 hours)
                      Induced Change TPI1 protein expression levels: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Inflammatory bowel disease [ICD-11: DD72]
                      Details It is reported that glutamine addition causes the increase of TPI1 protein expression compared with control group.
               Regulating Pair (2) Experim Info click to show the details of experiment for validating this pair [3]
                      Introduced Variation Glutamine decrease (48 hours)
                      Induced Change TPI1 protein expression levels: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Hepatocellular carcinoma [ICD-11: 2C12]
                      Details It is reported that glutamine decrease causes the increase of TPI1 protein expression compared with control group.
      Organic oxygen compounds
            Glucose Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [3]
                      Introduced Variation Glucose decrease (48 hours)
                      Induced Change TPI1 protein expression levels: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Hepatocellular carcinoma [ICD-11: 2C12]
                      Details It is reported that glucose decrease causes the increase of TPI1 protein expression compared with control group.
References
1 Arginine deficiency in preconfluent intestinal Caco-2 cells modulates expression of proteins involved in proliferation, apoptosis, and heat shock response. Proteomics. 2007 Feb;7(4):565-577.
2 Proteomic analysis of glutamine-treated human intestinal epithelial HCT-8 cells under basal and inflammatory conditions. Proteomics. 2006 Jul;6(13):3926-37.
3 cMyc-mediated activation of serine biosynthesis pathway is critical for cancer progression under nutrient deprivation conditions. Cell Res. 2015 Apr;25(4):429-44.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.