Details of Protein

General Information of Protein (ID: PRT00203)
Name Carbonic anhydrase I (CA1)
Synonyms   Click to Show/Hide Synonyms of This Protein
Carbonate dehydratase I; Carbonic anhydrase B; CAB; Carbonic anhydrase I; CA-I; CA1
Gene Name CA1 Gene ID
759
UniProt ID
P00915
Family Lyases (EC 4)
EC Number   EC: 4.2.1.1  (Click to Show/Hide the Complete EC Tree)
Lyases
Carbon-oxygen lyase
Hydro-lyase
EC: 4.2.1.1
  Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein
Sequence
MASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEI
INVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELH
VAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNF
DPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAV
PMQHNNRPTQPLKGRTVRASF
Structure
1AZM ; 1BZM ; 1CRM ; 1CZM ; 1HCB ; 1HUG ; 1HUH ; 1J9W ; 1JV0 ; 2CAB ; 2FOY ; 2FW4 ; 2IT4 ; 2NMX ; 2NN1 ; 2NN7 ; 3LXE ; 3W6H ; 3W6I ; 4WR7 ; 4WUP ; 4WUQ ; 5E2M ; 5GMM ; 6EVR ; 6EX1 ; 6F3B ; 6FAF ; 6FAG ; 6G3V ; 6HWZ ; 6I0J ; 6I0L ; 6SWM ; 6XZE ; 6XZO ; 6XZS ; 6XZX ; 6XZY ; 6Y00
Function Reversible hydration of carbon dioxide. Can hydrates cyanamide to urea.
Regulatory Network
Full List of Metabolite(s) Regulating This Protein
      Organic acids and derivatives
            Leucine Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Leucine addition (5 hours)
                      Induced Change CA1 protein expression levels: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that leucine addition causes the increase of CA1 protein expression compared with control group.
            Oxoglutaric acid Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [2]
                      Introduced Variation Oxoglutaric acid addition (336 hours)
                      Induced Change CA1 protein expression levels: decrease
                      Summary Introduced Variation         Induced Change 
                      Disease Status Parkinsonism [ICD-11: 8A00]
                      Details It is reported that oxoglutaric acid addition causes the decrease of CA1 protein expression compared with control group.
References
1 An enteral leucine supply modulates human duodenal mucosal proteome and decreases the expression of enzymes involved in fatty acid beta-oxidation. J Proteomics. 2013 Jan 14;78:535-44.
2 Dietary keto-acid feed-back on pituitary activity in gilthead sea bream: effects of oral doses of AKG. A proteomic approach. Gen Comp Endocrinol. 2010 Dec 1;169(3):284-92.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.