Details of Protein
| General Information of Protein (ID: PRT00202) | |||||
|---|---|---|---|---|---|
| Name | Diphosphomevalonate decarboxylase (MVD) | ||||
| Synonyms |
Click to Show/Hide Synonyms of This Protein
Mevalonate (diphospho)decarboxylase; MDDase; Mevalonate pyrophosphate decarboxylase; Mvd; Mpd
|
||||
| Gene Name | Mvd | Gene ID | |||
| UniProt ID | |||||
| Family | Lyases (EC 4) | ||||
| EC Number | EC: 4.1.1.33 (Click to Show/Hide the Complete EC Tree) | ||||
| Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein | |||||
| Sequence |
MASEKPQDLMVTCTAPVNIAVIKYWGKRDEALILPINSSLSVTLHQDQLKTTTTAAISKD
FTEDRIWLNGREEDVGQPRLQACLREIRRLARKRRSTGDGDALPLSLGYKVHVASVNNFP TAAGLASSAAGYACLAYTLARVYGVEGDLSEVARRGSGSACRSLYGGFVEWQMGEQADGK DSIARQIAPEWHWPQLRVLILVVSAEKKPTGSTVGMQTSVATSTLLKFRAESIVPERMKE MTRCIQEQDFQAFAQLTMKDSNQFHATCLDTFPPISYLNDTSRRIIQLVHRFNAHHGQTK VAYTFDAGPNAVIFTLEDTVAEFVAAVRHSFPPAANGDKFLKGLQVAPVLLSDELKTSLA TEPSPGGVQYIIATQVGPGPQVLDDPHHHLLGPDGLPQRDL |
||||
| Function | Catalyzes the ATP dependent decarboxylation of (R)-5-diphosphomevalonate to form isopentenyl diphosphate (IPP). Functions in the mevalonate (MVA) pathway leading to isopentenyl diphosphate (IPP), a key precursor for the biosynthesis of isoprenoids and sterol synthesis. | ||||
| Regulatory Network | |||||
| Full List of Metabolite(s) Regulating This Protein | ||||||
|---|---|---|---|---|---|---|
| Organic acids and derivatives | ||||||
| Leucine | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
| Detailed Information |
Metabo Info
click to show the details of this metabolite
|
|||||
| Regulating Pair |
Experim Info
click to show the details of experiment for validating this pair
|
[1] | ||||
| Introduced Variation | Leucine addition (72 hours) | |||||
| Induced Change | MVD mRNAlevel levels: increase | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Type 2 diabetes mellitus [ICD-11: 5A11] | |||||
| Details | It is reported that leucine addition causes the increase of MVD mRNA levels compared with control group. | |||||
| References | |||||
|---|---|---|---|---|---|
| 1 | Chronic exposure to leucine in vitro induces -cell dysfunction in INS-1E cells and mouse islets. J Endocrinol. 2012 Oct;215(1):79-88. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.

