Details of Protein
| General Information of Protein (ID: PRT00199) | |||||
|---|---|---|---|---|---|
| Name | Inorganic pyrophosphatase (PPA1) | ||||
| Synonyms |
Click to Show/Hide Synonyms of This Protein
Pyrophosphate phospho-hydrolase; PPase; Ppa1; Pp; Pyp
|
||||
| Gene Name | Ppa1 | Gene ID | |||
| UniProt ID | |||||
| Family | Hydrolases (EC 3) | ||||
| EC Number | EC: 3.6.1.1 (Click to Show/Hide the Complete EC Tree) | ||||
| Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein | |||||
| Sequence |
MSGFSSEERAAPFTLEYRVFLKNEKGQYISPFHDVPIYADKDVFHMVVEVPRWSNAKMEI
ATKDPLNPIKQDVKKGKLRYVANLFPYKGYIWNYGAIPQTWEDPGHSDKHTGCCGDNDPI DVCEIGSKVCARGEIIRVKVLGILAMIDEGETDWKVIAINVDDPDAANYKDISDVERLKP GYLEATVDWFRRYKVPDGKPENEFAFNAEFKNKDFAVDIIKSTHDYWKALVTKKTDGKGI SCMNTTVSESPFKCDPDAAKAIVDALPPPCESACSLPTDVDKWFHQQKN |
||||
| Regulatory Network | |||||
| Full List of Metabolite(s) Regulating This Protein | ||||||
|---|---|---|---|---|---|---|
| Organic acids and derivatives | ||||||
| Methionine | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
| Detailed Information |
Metabo Info
click to show the details of this metabolite
|
|||||
| Regulating Pair |
Experim Info
click to show the details of experiment for validating this pair
|
[1] | ||||
| Introduced Variation | Methionine decrease (504 hours) | |||||
| Induced Change | PPA1 protein expression levels: increase (FC = 2.30) | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Fatty liver disease [ICD-11: DB92] | |||||
| Details | It is reported that methionine decrease causes the increase of PPA1 protein expression compared with control group. | |||||
| References | |||||
|---|---|---|---|---|---|
| 1 | Proteomic analysis of mice fed methionine and choline deficient diet reveals marker proteins associated with steatohepatitis. PLoS One. 2015 Apr 7;10(4):e0120577. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.

