Details of Protein

General Information of Protein (ID: PRT00192)
Name Ubiquitin thioesterase L3 (UCHL3)
Synonyms   Click to Show/Hide Synonyms of This Protein
UCH-L3; Ubiquitin thioesterase L3; Uchl3
Gene Name Uchl3 Gene ID
50933
UniProt ID
Q9JKB1
Family Hydrolases (EC 3)
EC Number   EC: 3.4.19.12  (Click to Show/Hide the Complete EC Tree)
Hydrolases
Peptidase
Omega peptidase
EC: 3.4.19.12
  Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein
Sequence
MEGQRWLPLEANPEVTNQFLKQLGLHPNWQFVDVYGMEPELLSMVPRPVCAVLLLFPITE
KYEVFRTEEEEKIKSQGQDVTSSVYFMKQTISNACGTIGLIHAIANNKDKMHFESGSTLK
KFLEESVSMSPEERAKFLENYDAIRVTHETSAHEGQTEAPSIDEKVDLHFIALVHVDGHL
YELDGRKPFPINHGKTSDETLLEDAIEVCKKFMERDPDELRFNAIALSAA
Function Deubiquitinating enzyme (DUB) that controls levels of cellular ubiquitin through processing of ubiquitin precursors and ubiquitinated proteins. Thiol protease that recognizes and hydrolyzes a peptide bond at the C-terminal glycine of either ubiquitin or NEDD8. Has a 10-fold preference for Arg and Lys at position P3'', and exhibits a preference towards 'Lys-48'-linked ubiquitin chains. Deubiquitinates ENAC in apical compartments, thereby regulating apical membrane recycling. Indirectly increases the phosphorylation of IGFIR, AKT and FOXO1 and promotes insulin-signaling and insulin-induced adipogenesis. Required for stress-response retinal, skeletal muscle and germ cell maintenance. May be involved in working memory. Can hydrolyze UBB(+1), a mutated form of ubiquitin which is not effectively degraded by the proteasome.
Regulatory Network
Full List of Metabolite(s) Regulating This Protein
      Organic acids and derivatives
            Methionine Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Methionine addition (5 hours)
                      Induced Change UCHL3 protein expression levels: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Hyperhomocysteinaemia [ICD-11: 3B61]
                      Details It is reported that methionine addition causes the increase of UCHL3 protein expression compared with control group.
References
1 Regulatory cross-talk of mouse liver polyamine and methionine metabolic pathways: a systemic approach to its physiopathological consequences. Amino Acids. 2012 Feb;42(2-3):577-95.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.