Details of Protein

General Information of Protein (ID: PRT00183)
Name Sulfotransferase 1A1 (SULT1A1)
Synonyms   Click to Show/Hide Synonyms of This Protein
ST1A1; Aryl sulfotransferase 1; HAST1/HAST2; Phenol sulfotransferase 1; Phenol-sulfating phenol sulfotransferase 1; P-PST 1; ST1A3; Thermostable phenol sulfotransferase; Ts-PST; OK/SW-cl.88; SULT1A1; STP; STP1
Gene Name SULT1A1 Gene ID
6817
UniProt ID
P50225
Family Transferases (EC 2)
EC Number   EC: 2.8.2.1  (Click to Show/Hide the Complete EC Tree)
Transferase
Sulfotransferase
Sulfotransferase
EC: 2.8.2.1
  Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein
Sequence
MELIQDTSRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLISTYPKSGTTWVSQILDM
IYQGGDLEKCHRAPIFMRVPFLEFKAPGIPSGMETLKDTPAPRLLKTHLPLALLPQTLLD
QKVKVVYVARNAKDVAVSYYHFYHMAKVHPEPGTWDSFLEKFMVGEVSYGSWYQHVQEWW
ELSRTHPVLYLFYEDMKENPKREIQKILEFVGRSLPEETVDFVVQHTSFKEMKKNPMTNY
TTVPQEFMDHSISPFMRKGMAGDWKTTFTVAQNERFDADYAEKMAGCSLSFRSEL
Structure
1LS6 ; 1Z28 ; 2D06 ; 3QVU ; 3QVV ; 3U3J ; 3U3K ; 3U3M ; 3U3O ; 3U3R ; 4GRA
Function Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to catalyze the sulfate conjugation of a wide variety of acceptor molecules bearing a hydroxyl or an amine groupe. Sulfonation increases the water solubility of most compounds, and therefore their renal excretion, but it can also result in bioactivation to form active metabolites. Displays broad substrate specificity for small phenolic compounds. Plays an important role in the sulfonation of endogenous molecules such as steroid hormones and 3,3'-diiodothyronin. Mediates the sulfate conjugation of a variety of xenobiotics, including the drugs acetaminophen and minoxidil. Mediates also the metabolic activation of carcinogenic N-hydroxyarylamines leading to highly reactive intermediates capable of forming DNA adducts, potentially resulting in mutagenesis.
Regulatory Network
Full List of Metabolite(s) Regulating This Protein
      Organic acids and derivatives
            Leucine Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Leucine addition (5 hours)
                      Induced Change SULT1A1 protein expression levels: decrease
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that leucine addition causes the decrease of SULT1A1 protein expression compared with control group.
References
1 An enteral leucine supply modulates human duodenal mucosal proteome and decreases the expression of enzymes involved in fatty acid beta-oxidation. J Proteomics. 2013 Jan 14;78:535-44.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.