Details of Protein
General Information of Protein (ID: PRT00165) | |||||
---|---|---|---|---|---|
Name | Glutathione S-transferase Mu 3 (GSTM3) | ||||
Synonyms |
Click to Show/Hide Synonyms of This Protein
GST class-mu 3; GSTM3-3; hGSTM3-3; GSTM3; GST5
|
||||
Gene Name | GSTM3 | Gene ID | |||
UniProt ID | |||||
Family | Transferases (EC 2) | ||||
EC Number | EC: 2.5.1.18 (Click to Show/Hide the Complete EC Tree) | ||||
Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein | |||||
Sequence |
MSCESSMVLGYWDIRGLAHAIRLLLEFTDTSYEEKRYTCGEAPDYDRSQWLDVKFKLDLD
FPNLPYLLDGKNKITQSNAILRYIARKHNMCGETEEEKIRVDIIENQVMDFRTQLIRLCY SSDHEKLKPQYLEELPGQLKQFSMFLGKFSWFAGEKLTFVDFLTYDILDQNRIFDPKCLD EFPNLKAFMCRFEALEKIAAYLQSDQFCKMPINNKMAQWGNKPVC |
||||
Structure | |||||
Function | Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. May govern uptake and detoxification of both endogenous compounds and xenobiotics at the testis and brain blood barriers. | ||||
Regulatory Network | |||||
Full List of Metabolite(s) Regulating This Protein | ||||||
---|---|---|---|---|---|---|
Organic acids and derivatives | ||||||
Methionine | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
Detailed Information |
Metabo Info
![]() |
|||||
Regulating Pair |
Experim Info
![]() |
[1] | ||||
Introduced Variation | Methionine decrease (120 hours) | |||||
Induced Change | GSTM3 protein expression levels: decrease | |||||
Summary | Introduced Variation
![]() ![]() ![]() |
|||||
Disease Status | Stomach cancer [ICD-11: 2B72] | |||||
Details | It is reported that methionine decrease causes the decrease of GSTM3 protein expression compared with control group. | |||||
References | |||||
---|---|---|---|---|---|
1 | Applying proteomic methodologies to analyze the effect of methionine restriction on proliferation of human gastric cancer SGC7901 cells. Clin Chim Acta. 2007 Feb;377(1-2):206-12. |
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.