Details of Protein
General Information of Protein (ID: PRT00159) | |||||
---|---|---|---|---|---|
Name | Farnesyl pyrophosphate synthase (FDPS) | ||||
Synonyms |
Click to Show/Hide Synonyms of This Protein
FPP synthase; FPS; (2E,6E)-farnesyl diphosphate synthase; Cholesterol-regulated 39 kDa protein; CR 39; Dimethylallyltranstransferase; Farnesyl diphosphate synthase; Geranyltranstransferase; Fdps
|
||||
Gene Name | Fdps | Gene ID | |||
UniProt ID | |||||
Family | Transferases (EC 2) | ||||
EC Number | EC: 2.5.1.10 (Click to Show/Hide the Complete EC Tree) | ||||
Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein | |||||
Sequence |
MNGNQKLDAYNQEKQNFIQHFSQIVKVLTEKELGHPEIGDAIARLKEVLEYNALGGKYNR
GLTVVQAFQELVEPKKQDAESLQRALTVGWCVELLQAFFLVSDDIMDSSLTRRGQICWYQ KPGIGLDAINDALLLEASIYRLLKFYCREQPYYLNLLELFLQSSYQTEIGQTLDLMTAPQ GHVDLGRYTEKRYKSIVKYKTAFYSFYLPIAAAMYMAGIDGEKEHANALKILMEMGEFFQ VQDDYLDLFGDPSVTGKVGTDIQDNKCSWLVVQCLLRASPQQRQILEENYGQKDPEKVAR VKALYEALDLQSAFFKYEEDSYNRLKSLIEQCSAPLPPSIFMELANKIYKRRK |
||||
Function | Key enzyme in isoprenoid biosynthesis which catalyzes the formation of farnesyl diphosphate (FPP), a precursor for several classes of essential metabolites including sterols, dolichols, carotenoids, and ubiquinones. FPP also serves as substrate for protein farnesylation and geranylgeranylation. Catalyzes the sequential condensation of isopentenyl pyrophosphate with the allylic pyrophosphates, dimethylallyl pyrophosphate, and then with the resultant geranylpyrophosphate to the ultimate product farnesyl pyrophosphate. | ||||
Regulatory Network | |||||
Full List of Metabolite(s) Regulating This Protein | ||||||
---|---|---|---|---|---|---|
Organic acids and derivatives | ||||||
Methionine | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
Detailed Information |
Metabo Info
![]() |
|||||
Regulating Pair |
Experim Info
![]() |
[1] | ||||
Introduced Variation | Methionine addition (336 hours) | |||||
Induced Change | FDPS protein expression levels: increase | |||||
Summary | Introduced Variation
![]() ![]() ![]() |
|||||
Disease Status | Hyperhomocysteinaemia [ICD-11: 3B61] | |||||
Details | It is reported that methionine addition causes the increase of FDPS protein expression compared with control group. | |||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.