Details of Protein

General Information of Protein (ID: PRT00151)
Name Serine hydroxymethyltransferase (GLYA)
Synonyms   Click to Show/Hide Synonyms of This Protein
SHMT; Serine methylase; b2551; JW2535; glyA
Gene Name glyA Gene ID
58461316
UniProt ID
P0A825
Family Transferases (EC 2)
EC Number   EC: 2.1.2.1  (Click to Show/Hide the Complete EC Tree)
Transferase
Methylase
Hydroxymethyl-, formyl- and related transferase
EC: 2.1.2.1
  Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein
Sequence
MLKREMNIADYDAELWQAMEQEKVRQEEHIELIASENYTSPRVMQAQGSQLTNKYAEGYP
GKRYYGGCEYVDIVEQLAIDRAKELFGADYANVQPHSGSQANFAVYTALLEPGDTVLGMN
LAHGGHLTHGSPVNFSGKLYNIVPYGIDATGHIDYADLEKQAKEHKPKMIIGGFSAYSGV
VDWAKMREIADSIGAYLFVDMAHVAGLVAAGVYPNPVPHAHVVTTTTHKTLAGPRGGLIL
AKGGSEELYKKLNSAVFPGGQGGPLMHVIAGKAVALKEAMEPEFKTYQQQVAKNAKAMVE
VFLERGYKVVSGGTDNHLFLVDLVDKNLTGKEADAALGRANITVNKNSVPNDPKSPFVTS
GIRVGTPAITRRGFKEAEAKELAGWMCDVLDSINDEAVIERIKGKVLDICARYPVYA
Structure
1DFO ; 1EQB ; 3G8M
Function Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism. Thus, is able to catalyze the cleavage of allothreonine and 3-phenylserine. Also catalyzes the irreversible conversion of 5,10-methenyltetrahydrofolate to 5-formyltetrahydrofolate.
Regulatory Network
Full List of Metabolite(s) Regulating This Protein
      Organic acids and derivatives
            Glycine Click to Show/Hide the Full List of Regulating Pair(s):   2 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair (1) Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Glycine addition (0.5 hour)
                      Induced Change GLYA protein expression levels: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Acute infection [ICD-11: 1D00]
                      Details It is reported that glycine addition causes the increase of GLYA protein expression compared with control group.
               Regulating Pair (2) Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Glycine addition (0.5 hour)
                      Induced Change GLYA mRNA levels: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Acute infection [ICD-11: 1D00]
                      Details It is reported that glycine addition causes the increase of GLYA mRNA levels compared with control group.
            Serine Click to Show/Hide the Full List of Regulating Pair(s):   2 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair (1) Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Serine addition (0.5 hour)
                      Induced Change GLYA protein expression levels: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Acute infection [ICD-11: 1D00]
                      Details It is reported that serine addition causes the increase of GLYA protein expression compared with control group.
               Regulating Pair (2) Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Serine addition (0.5 hour)
                      Induced Change GLYA mRNA levels: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Acute infection [ICD-11: 1D00]
                      Details It is reported that serine addition causes the increase of GLYA mRNA levels compared with control group.
References
1 Glycine, serine and threonine metabolism confounds efficacy of complement-mediated killing. Nat Commun. 2019 Jul 25;10(1):3325.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.