Details of Protein

General Information of Protein (ID: PRT00128)
Name Lactate dehydrogenase A (LDHA)
Synonyms   Click to Show/Hide Synonyms of This Protein
LDH-A; Cell proliferation-inducing gene 19 protein; LDH muscle subunit; LDH-M; Renal carcinoma antigen NY-REN-59; PIG19; LDHA
Gene Name LDHA Gene ID
3939
UniProt ID
P00338
Family Oxidoreductases (EC 1)
EC Number   EC: 1.1.1.27  (Click to Show/Hide the Complete EC Tree)
Oxidoreductase
CH-OH donor oxidoreductase
NAD/NADP oxidoreductase
EC: 1.1.1.27
  Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein
Sequence
MATLKDQLIYNLLKEEQTPQNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKG
EMMDLQHGSLFLRTPKIVSGKDYNVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFI
IPNVVKYSPNCKLLIVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGV
HPLSCHGWVLGEHGDSSVPVWSGMNVAGVSLKTLHPDLGTDKDKEQWKEVHKQVVESAYE
VIKLKGYTSWAIGLSVADLAESIMKNLRRVHPVSTMIKGLYGIKDDVFLSVPCILGQNGI
SDLVKVTLTSEEEARLKKSADTLWGIQKELQF
Structure
1I10 ; 4AJP ; 4JNK ; 4L4R ; 4L4S ; 4M49 ; 4OJN ; 4OKN ; 4QO7 ; 4QO8 ; 4QSM ; 4QT0 ; 4R68 ; 4R69 ; 4RLS ; 4ZVV ; 5IXS ; 5IXY ; 5W8H ; 5W8I ; 5W8J ; 5W8K ; 5W8L ; 5ZJD ; 5ZJE ; 5ZJF ; 6BAD ; 6BAG ; 6BAX ; 6BAZ ; 6BB0 ; 6BB1 ; 6BB2 ; 6BB3 ; 6MV8 ; 6MVA ; 6Q0D ; 6Q13 ; 6SBU ; 6SBV ; 6ZZR
Regulatory Network
Full List of Metabolite(s) Regulating This Protein
      Organic acids and derivatives
            Glutamine Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Glutamine decrease (48 hours)
                      Induced Change LDHA protein expression levels: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Hepatocellular carcinoma [ICD-11: 2C12]
                      Details It is reported that glutamine decrease causes the increase of LDHA protein expression compared with control group.
      Organic oxygen compounds
            Glucose Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Glucose decrease (48 hours)
                      Induced Change LDHA protein expression levels: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Hepatocellular carcinoma [ICD-11: 2C12]
                      Details It is reported that glucose decrease causes the increase of LDHA protein expression compared with control group.
References
1 cMyc-mediated activation of serine biosynthesis pathway is critical for cancer progression under nutrient deprivation conditions. Cell Res. 2015 Apr;25(4):429-44.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.