Details of Protein

General Information of Protein (ID: PRT00124)
Name Alcohol dehydrogenase 1C (ADH1C)
Synonyms   Click to Show/Hide Synonyms of This Protein
Alcohol dehydrogenase subunit gamma; ADH1C; ADH3
Gene Name ADH1C Gene ID
126
UniProt ID
P00326
Family Oxidoreductases (EC 1)
EC Number   EC: 1.1.1.1  (Click to Show/Hide the Complete EC Tree)
Oxidoreductase
CH-OH donor oxidoreductase
NAD/NADP oxidoreductase
EC: 1.1.1.1
  Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein
Sequence
MSTAGKVIKCKAAVLWELKKPFSIEEVEVAPPKAHEVRIKMVAAGICRSDEHVVSGNLVT
PLPVILGHEAAGIVESVGEGVTTVKPGDKVIPLFTPQCGKCRICKNPESNYCLKNDLGNP
RGTLQDGTRRFTCSGKPIHHFVGVSTFSQYTVVDENAVAKIDAASPLEKVCLIGCGFSTG
YGSAVKVAKVTPGSTCAVFGLGGVGLSVVMGCKAAGAARIIAVDINKDKFAKAKELGATE
CINPQDYKKPIQEVLKEMTDGGVDFSFEVIGRLDTMMASLLCCHEACGTSVIVGVPPDSQ
NLSINPMLLLTGRTWKGAIFGGFKSKESVPKLVADFMAKKFSLDALITNILPFEKINEGF
DLLRSGKSIRTVLTF
Structure
1DDA ; 1HT0 ; 1U3W
Regulatory Network
Full List of Metabolite(s) Regulating This Protein
      Homogeneous non-metal compounds
            Nitrogen Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Nitrogen limitation (16 hours)
                      Induced Change ADH1C protein expression levels: increase (FC = 11.02)
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that nitrogen limitation causes the increase of ADH1C protein expression compared with control group.
      Organic acids and derivatives
            Arginine Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [2]
                      Introduced Variation Arginine addition (16 hours)
                      Induced Change ADH1C protein abundance levels: increase (FC = 11.02)
                      Summary Introduced Variation         Induced Change 
                      Disease Status Hepatocellular carcinoma [ICD-11: 2C12]
                      Details It is reported that arginine addition causes the increase of ADH1C protein abundance compared with control group.
            Glutamine Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [3]
                      Introduced Variation Glutamine absence (16 hours)
                      Induced Change ADH1C protein abundance levels: increase (FC = 11.02)
                      Summary Introduced Variation         Induced Change 
                      Disease Status Hepatocellular carcinoma [ICD-11: 2C12]
                      Details It is reported that glutamine absence causes the increase of ADH1C protein abundance compared with control group.
References
1 Proteome analysis of yeast response to various nutrient limitations. Mol Syst Biol. 2006;2:2006.0026.
2 Comparative Proteomics Analysis Reveals L-Arginine Activates Ethanol Degradation Pathways in HepG2 Cells. Sci Rep. 2016 Mar 17;6:23340.
3 Quantitative proteomics analysis reveals glutamine deprivation activates fatty acid -oxidation pathway in HepG2 cells. Amino Acids. 2016 May;48(5):1297-307.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.