Details of Protein
General Information of Protein (ID: PRT00121) | |||||
---|---|---|---|---|---|
Name | Prolactin (PRL) | ||||
Synonyms |
Click to Show/Hide Synonyms of This Protein
PRL
|
||||
Gene Name | PRL | Gene ID | |||
UniProt ID | |||||
Family | Somatotropin (Soma) | ||||
Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein | |||||
Sequence |
MNIKGSPWKGSLLLLLVSNLLLCQSVAPLPICPGGAARCQVTLRDLFDRAVVLSHYIHNL
SSEMFSEFDKRYTHGRGFITKAINSCHTSSLATPEDKEQAQQMNQKDFLSLIVSILRSWN EPLYHLVTEVRGMQEAPEAILSKAVEIEEQTKRLLEGMELIVSQVHPETKENEIYPVWSG LPSLQMADEESRLSAYYNLLHCLRRDSHKIDNYLKLLKCRIIHNNNC |
||||
Structure | |||||
Function | Prolactin acts primarily on the mammary gland by promoting lactation. | ||||
Regulatory Network | |||||
Full List of Metabolite(s) Regulating This Protein | ||||||
---|---|---|---|---|---|---|
Organic acids and derivatives | ||||||
Oxoglutaric acid | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
Detailed Information |
Metabo Info
![]() |
|||||
Regulating Pair |
Experim Info
![]() |
[1] | ||||
Introduced Variation | Oxoglutaric acid addition (336 hours) | |||||
Induced Change | PRL protein expression levels: decrease | |||||
Summary | Introduced Variation
![]() ![]() ![]() |
|||||
Disease Status | Parkinsonism [ICD-11: 8A00] | |||||
Details | It is reported that oxoglutaric acid addition causes the decrease of PRL protein expression compared with control group. | |||||
References | |||||
---|---|---|---|---|---|
1 | Dietary keto-acid feed-back on pituitary activity in gilthead sea bream: effects of oral doses of AKG. A proteomic approach. Gen Comp Endocrinol. 2010 Dec 1;169(3):284-92. |
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.