Details of Protein
| General Information of Protein (ID: PRT00121) | |||||
|---|---|---|---|---|---|
| Name | Prolactin (PRL) | ||||
| Synonyms |
Click to Show/Hide Synonyms of This Protein
PRL
|
||||
| Gene Name | PRL | Gene ID | |||
| UniProt ID | |||||
| Family | Somatotropin (Soma) | ||||
| Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein | |||||
| Sequence |
MNIKGSPWKGSLLLLLVSNLLLCQSVAPLPICPGGAARCQVTLRDLFDRAVVLSHYIHNL
SSEMFSEFDKRYTHGRGFITKAINSCHTSSLATPEDKEQAQQMNQKDFLSLIVSILRSWN EPLYHLVTEVRGMQEAPEAILSKAVEIEEQTKRLLEGMELIVSQVHPETKENEIYPVWSG LPSLQMADEESRLSAYYNLLHCLRRDSHKIDNYLKLLKCRIIHNNNC |
||||
| Structure | |||||
| Function | Prolactin acts primarily on the mammary gland by promoting lactation. | ||||
| Regulatory Network | |||||
| Full List of Metabolite(s) Regulating This Protein | ||||||
|---|---|---|---|---|---|---|
| Organic acids and derivatives | ||||||
| Oxoglutaric acid | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
| Detailed Information |
Metabo Info
click to show the details of this metabolite
|
|||||
| Regulating Pair |
Experim Info
click to show the details of experiment for validating this pair
|
[1] | ||||
| Introduced Variation | Oxoglutaric acid addition (336 hours) | |||||
| Induced Change | PRL protein expression levels: decrease | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Parkinsonism [ICD-11: 8A00] | |||||
| Details | It is reported that oxoglutaric acid addition causes the decrease of PRL protein expression compared with control group. | |||||
| References | |||||
|---|---|---|---|---|---|
| 1 | Dietary keto-acid feed-back on pituitary activity in gilthead sea bream: effects of oral doses of AKG. A proteomic approach. Gen Comp Endocrinol. 2010 Dec 1;169(3):284-92. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.

