Details of Protein

General Information of Protein (ID: PRT00100)
Name Plasma retinol-binding protein (RBP4)
Synonyms   Click to Show/Hide Synonyms of This Protein
Plasma retinol-binding protein; PRBP; RBP; PRO2222; RBP4
Gene Name RBP4 Gene ID
5950
UniProt ID
P02753
Family Lipocalin (LipC)
  Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein
Sequence
MKWVWALLLLAALGSGRAERDCRVSSFRVKENFDKARFSGTWYAMAKKDPEGLFLQDNIV
AEFSVDETGQMSATAKGRVRLLNNWDVCADMVGTFTDTEDPAKFKMKYWGVASFLQKGND
DHWIVDTDYDTYAVQYSCRLLNLDGTCADSYSFVFSRDPNGLPPEAQKIVRQRQEELCLA
RQYRLIVHNGYCDGRSERNLL
Structure
1BRP ; 1BRQ ; 1JYD ; 1JYJ ; 1QAB ; 1RBP ; 1RLB ; 2WQ9 ; 2WQA ; 2WR6 ; 3BSZ ; 3FMZ ; 4O9S ; 4PSQ ; 5NTY ; 5NU2 ; 5NU6 ; 5NU7 ; 5NU8 ; 5NU9 ; 5NUA ; 5NUB ; 6QBA
Function Retinol-binding protein that mediates retinol transport in blood plasma. Delivers retinol from the liver stores to the peripheral tissues (Probable). Transfers the bound all-trans retinol to STRA6, that then facilitates retinol transport across the cell membrane.
Regulatory Network
Full List of Metabolite(s) Regulating This Protein
      Organic acids and derivatives
            Glutamine Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Glutamine addition (576 hours)
                      Induced Change RBP4 protein expression levels: decrease
                      Summary Introduced Variation         Induced Change 
                      Disease Status Colon cancer [ICD-11: 2B90]
                      Details It is reported that glutamine addition causes the decrease of RBP4 protein expression compared with control group.
References
1 Glutamine regulates the expression of proteins with a potential health-promoting effect in human intestinal Caco-2 cells. Proteomics. 2006 Apr;6(8):2454-64.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.