Details of Protein

General Information of Protein (ID: PRT00099)
Name Major urinary protein 11 (MUP11)
Synonyms   Click to Show/Hide Synonyms of This Protein
Mup11; Mup9
Gene Name Mup11 Gene ID
100039028
UniProt ID
P04938
Family Lipocalin (LipC)
  Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein
Sequence
MKMLLLLLCLGLTLVCVHAEEASSTGRNFNVEKINGEWHTIILASDKREKIEDNGNFRLF
LEQIHVLENSLVLKFHTVRDEECSELSMVADKTEKAGEYSVTYDGFNTFTIPKTDYDNFL
MAHLINEKDGETFQLMGLYGREPDLSSDIKERFAQLCEEHGILRENIIDLSNANRCLQAR
E
Structure
2LB6
Function Major urinary proteins (Mups) bind pheromones, and thus stabilize them to allow slow release into the air from urine marks. May protect pheromones from oxidation. May also act as pheromones themselves. In this context, they play a role in the regulation of social behaviors, such as aggression, mating, pup-suckling, territory establishment and dominance (Probable). Binds the pheromone analog 2-sec-butyl-4,5-dihydrothiazole (SBT) in vitro.
Regulatory Network
Full List of Metabolite(s) Regulating This Protein
      Organic acids and derivatives
            Methionine Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Methionine decrease (504 hours)
                      Induced Change MUP11 protein expression levels: decrease (FC = 0.10)
                      Summary Introduced Variation         Induced Change 
                      Disease Status Fatty liver disease [ICD-11: DB92]
                      Details It is reported that methionine decrease causes the decrease of MUP11 protein expression compared with control group.
References
1 Proteomic analysis of mice fed methionine and choline deficient diet reveals marker proteins associated with steatohepatitis. PLoS One. 2015 Apr 7;10(4):e0120577.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.