Details of Protein
| General Information of Protein (ID: PRT00099) | |||||
|---|---|---|---|---|---|
| Name | Major urinary protein 11 (MUP11) | ||||
| Synonyms |
Click to Show/Hide Synonyms of This Protein
Mup11; Mup9
|
||||
| Gene Name | Mup11 | Gene ID | |||
| UniProt ID | |||||
| Family | Lipocalin (LipC) | ||||
| Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein | |||||
| Sequence |
MKMLLLLLCLGLTLVCVHAEEASSTGRNFNVEKINGEWHTIILASDKREKIEDNGNFRLF
LEQIHVLENSLVLKFHTVRDEECSELSMVADKTEKAGEYSVTYDGFNTFTIPKTDYDNFL MAHLINEKDGETFQLMGLYGREPDLSSDIKERFAQLCEEHGILRENIIDLSNANRCLQAR E |
||||
| Structure | |||||
| Function | Major urinary proteins (Mups) bind pheromones, and thus stabilize them to allow slow release into the air from urine marks. May protect pheromones from oxidation. May also act as pheromones themselves. In this context, they play a role in the regulation of social behaviors, such as aggression, mating, pup-suckling, territory establishment and dominance (Probable). Binds the pheromone analog 2-sec-butyl-4,5-dihydrothiazole (SBT) in vitro. | ||||
| Regulatory Network | |||||
| Full List of Metabolite(s) Regulating This Protein | ||||||
|---|---|---|---|---|---|---|
| Organic acids and derivatives | ||||||
| Methionine | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
| Detailed Information |
Metabo Info
click to show the details of this metabolite
|
|||||
| Regulating Pair |
Experim Info
click to show the details of experiment for validating this pair
|
[1] | ||||
| Introduced Variation | Methionine decrease (504 hours) | |||||
| Induced Change | MUP11 protein expression levels: decrease (FC = 0.10) | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Fatty liver disease [ICD-11: DB92] | |||||
| Details | It is reported that methionine decrease causes the decrease of MUP11 protein expression compared with control group. | |||||
| References | |||||
|---|---|---|---|---|---|
| 1 | Proteomic analysis of mice fed methionine and choline deficient diet reveals marker proteins associated with steatohepatitis. PLoS One. 2015 Apr 7;10(4):e0120577. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.

