Details of Protein

General Information of Protein (ID: PRT00097)
Name Interleukin-8 (IL8)
Synonyms   Click to Show/Hide Synonyms of This Protein
IL-8; C-X-C motif chemokine 8; Chemokine (C-X-C motif) ligand 8; Emoctakin; Granulocyte chemotactic protein 1; GCP-1; Monocyte-derived neutrophil chemotactic factor; MDNCF; Monocyte-derived neutrophil-activating peptide; MONAP; Neutrophil-activating protein 1; NAP-1; Protein 3-10C; T-cell chemotactic factor; CXCL8; IL8
Gene Name CXCL8 Gene ID
3576
UniProt ID
P10145
Family Interleukin (IL)
  Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein
Sequence
MTSKLAVALLAAFLISAALCEGAVLPRSAKELRCQCIKTYSKPFHPKFIKELRVIESGPH
CANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS
Structure
1ICW ; 1IKL ; 1IKM ; 1IL8 ; 1ILP ; 1ILQ ; 1QE6 ; 1ROD ; 2IL8 ; 3IL8 ; 4XDX ; 5D14 ; 5WDZ ; 6LFM ; 6LFO ; 6N2U ; 6WZM
Function IL-8 is a chemotactic factor that attracts neutrophils, basophils, and T-cells, but not monocytes. It is also involved in neutrophil activation. It is released from several cell types in response to an inflammatory stimulus. IL-8(6-77) has a 5-10-fold higher activity on neutrophil activation, IL-8(5-77) has increased activity on neutrophil activation and IL-8(7-77) has a higher affinity to receptors CXCR1 and CXCR2 as compared to IL-8(1-77), respectively.
Regulatory Network
Full List of Metabolite(s) Regulating This Protein
      Organic acids and derivatives
            Gamma-Glutamylvaline Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Gamma-Glutamylvaline addition (2 hours)
                      Induced Change CXCL8 protein expression levels: decrease
                      Summary Introduced Variation         Induced Change 
                      Disease Status Peritonitis [ICD-11: DC50]
                      Details It is reported that gamma-glutamylvaline addition causes the decrease of CXCL8 protein expression compared with control group.
            Glutamine Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [2]
                      Introduced Variation Glutamine addition (18 hours)
                      Induced Change CXCL8 protein expression levels: decrease
                      Summary Introduced Variation         Induced Change 
                      Disease Status Inflammatory bowel disease [ICD-11: DD72]
                      Details It is reported that glutamine addition causes the decrease of CXCL8 protein expression compared with control group.
References
1 Dietary -Glutamyl Valine Ameliorates TNF--Induced Vascular Inflammation via Endothelial Calcium-Sensing Receptors. J Agric Food Chem. 2020 Aug 26;68(34):9139-9149.
2 Modulating effect of glutamine on IL-1beta-induced cytokine production by human gut. Clin Nutr. 2003 Aug;22(4):407-13.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.