Details of Protein
| General Information of Protein (ID: PRT00090) | |||||
|---|---|---|---|---|---|
| Name | Interleukin-10 (IL10) | ||||
| Synonyms |
Click to Show/Hide Synonyms of This Protein
IL-10; Cytokine synthesis inhibitory factor; CSIF; IL10
|
||||
| Gene Name | IL10 | Gene ID | |||
| UniProt ID | |||||
| Family | Interleukin (IL) | ||||
| Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein | |||||
| Sequence |
MHSSALLCCLVLLTGVRASPGQGTQSENSCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQ
LDNLLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENLKTLR LRLRRCHRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIRN |
||||
| Structure | |||||
| Function | Major immune regulatory cytokine that acts on many cells of the immune system where it has profound anti-inflammatory functions, limiting excessive tissue disruption caused by inflammation. Mechanistically, IL10 binds to its heterotetrameric receptor comprising IL10RA and IL10RB leading to JAK1 and STAT2-mediated phosphorylation of STAT3. In turn, STAT3 translocates to the nucleus where it drives expression of anti-inflammatory mediators. Targets antigen-presenting cells (APCs) such as macrophages and monocytes and inhibits their release of pro-inflammatory cytokines including granulocyte-macrophage colony-stimulating factor /GM-CSF, granulocyte colony-stimulating factor/G-CSF, IL-1 alpha, IL-1 beta, IL-6, IL-8 and TNF-alpha. Interferes also with antigen presentation by reducing the expression of MHC-class II and co-stimulatory molecules, thereby inhibiting their ability to induce T cell activation. In addition, controls the inflammatory response of macrophages by reprogramming essential metabolic pathways including mTOR signaling. | ||||
| Regulatory Network | |||||
| Full List of Metabolite(s) Regulating This Protein | ||||||
|---|---|---|---|---|---|---|
| Organic acids and derivatives | ||||||
| Glutamine | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
| Detailed Information |
Metabo Info
 click to show the details of this metabolite
|
|||||
| Regulating Pair |
Experim Info
click to show the details of experiment for validating this pair
|
[1] | ||||
| Introduced Variation | Glutamine addition (18 hours) | |||||
| Induced Change | IL10 mRNAlevel levels: increase | |||||
| Summary | Introduced Variation
Induced Change
|
|||||
| Disease Status | Inflammatory bowel disease [ICD-11: DD72] | |||||
| Details | It is reported that glutamine addition causes the increase of IL10 mRNA levels compared with control group. | |||||
| References | |||||
|---|---|---|---|---|---|
| 1 | Modulating effect of glutamine on IL-1beta-induced cytokine production by human gut. Clin Nutr. 2003 Aug;22(4):407-13. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.