Details of Protein
| General Information of Protein (ID: PRT00089) | |||||
|---|---|---|---|---|---|
| Name | Interferon-beta (IFNB1) | ||||
| Synonyms |
Click to Show/Hide Synonyms of This Protein
IFN-beta; Ifnb1; Ifb; Ifnb
|
||||
| Gene Name | Ifnb1 | Gene ID | |||
| UniProt ID | |||||
| Family | Interferon (IF) | ||||
| Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein | |||||
| Sequence |
MNNRWILHAAFLLCFSTTALSINYKQLQLQERTNIRKCQELLEQLNGKINLTYRADFKIP
MEMTEKMQKSYTAFAIQEMLQNVFLVFRNNFSSTGWNETIVVRLLDELHQQTVFLKTVLE EKQEERLTWEMSSTALHLKSYYWRVQRYLKLMKYNSYAWMVVRAEIFRNFLIIRRLTRNF QN |
||||
| Structure | |||||
| Function | Has antiviral, antibacterial and anticancer activities. | ||||
| Regulatory Network | |||||
| Full List of Metabolite(s) Regulating This Protein | ||||||
|---|---|---|---|---|---|---|
| Organic oxygen compounds | ||||||
| Glucose | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
| Detailed Information |
Metabo Info
 click to show the details of this metabolite
|
|||||
| Regulating Pair |
Experim Info
click to show the details of experiment for validating this pair
|
[1] | ||||
| Introduced Variation | Glucose decrease (4 hours) | |||||
| Induced Change | IFNB1 mRNA levels: increase (FC = 2) | |||||
| Summary | Introduced Variation
Induced Change
|
|||||
| Disease Status | Acute lymphoblastic leukemia [ICD-11: 2B33] | |||||
| Details | It is reported that glucose decrease causes the increase of IFNB1 mRNA levels compared with control group. | |||||
| References | |||||
|---|---|---|---|---|---|
| 1 | Lactate Is a Natural Suppressor of RLR Signaling by Targeting MAVS. Cell. 2019 Jun 27;178(1):176-189.e15. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.