Details of Protein
General Information of Protein (ID: PRT00086) | |||||
---|---|---|---|---|---|
Name | Insulin-2 (INS2) | ||||
Synonyms |
Click to Show/Hide Synonyms of This Protein
Ins2; Ins-2
|
||||
Gene Name | Ins2 | Gene ID | |||
UniProt ID | |||||
Family | Insulin (Insu) | ||||
Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein | |||||
Sequence |
MALWIRFLPLLALLILWEPRPAQAFVKQHLCGSHLVEALYLVCGERGFFYTPMSRREVED
PQVAQLELGGGPGAGDLQTLALEVARQKRGIVDQCCTSICSLYQLENYCN |
||||
Function | Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver. | ||||
Regulatory Network | |||||
Full List of Metabolite(s) Regulating This Protein | ||||||
---|---|---|---|---|---|---|
Organic acids and derivatives | ||||||
Leucine | Click to Show/Hide the Full List of Regulating Pair(s): 3 Pair(s) | |||||
Detailed Information |
Metabo Info
![]() |
|||||
Regulating Pair (1) |
Experim Info
![]() |
[1] | ||||
Introduced Variation | Leucine addition (288 hours) | |||||
Induced Change | INS2 protein expression levels: increase | |||||
Summary | Introduced Variation
![]() ![]() ![]() |
|||||
Disease Status | Healthy individual | |||||
Details | It is reported that leucine addition causes the increase of INS2 protein expression compared with control group. | |||||
Regulating Pair (2) |
Experim Info
![]() |
[2] | ||||
Introduced Variation | Leucine addition (72 hours) | |||||
Induced Change | INS2 mRNAlevel levels: increase | |||||
Summary | Introduced Variation
![]() ![]() ![]() |
|||||
Disease Status | Type 2 diabetes mellitus [ICD-11: 5A11] | |||||
Details | It is reported that leucine addition causes the increase of INS2 mRNA levels compared with control group. | |||||
Regulating Pair (3) |
Experim Info
![]() |
[2] | ||||
Introduced Variation | Leucine addition (72 hours) | |||||
Induced Change | INS2 protein expression levels: decrease | |||||
Summary | Introduced Variation
![]() ![]() ![]() |
|||||
Disease Status | Type 2 diabetes mellitus [ICD-11: 5A11] | |||||
Details | It is reported that leucine addition causes the decrease of INS2 protein expression compared with control group. | |||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.